• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Molecular markers closely linked to fusarium resistance genes in
Molecular markers closely linked to fusarium resistance genes in

... Elmer Geneamp 9700 thermal cycler using random 10-mer primers procured from Eurogentec (Cologne, Germany), Operon Technologies (Alameda, USA) or Roth (Karlsruhe, Germany), respectively. Each 15 ml PCR reaction contained 1.5 ml of 10  PCR buffer, 2.5 mM of MgCl2; 10 mM of dNTP-mix; 0.4 U of “Silvers ...
Analyzing stochastic transcription to elucidate the nucleoid`s
Analyzing stochastic transcription to elucidate the nucleoid`s

... chromosome (a gene distance of around 650). Similarly, Figures 1b and 1c show the results for the chromosome and the megaplasmid pSymB, respectively, when both are actively transcribed (and translated; data set A). As can be seen, the autocorrelation functions for the three replicons are similar. No ...
Research Primer - Cellular Neurobiology
Research Primer - Cellular Neurobiology

... surprising to choose the fruit fly, which uses the independently evolved ‘Johnston’s organ’ to hear. Yet an ever-growing body of evidence justifies this selection. It seems that not only is it very likely that the two auditory systems share aspects of genetic heritage, but that they still possess so ...
Chapter 12
Chapter 12

... – Only 1.5% of the DNA codes for proteins, tRNAs, or rRNAs – The remaining 88.5% of the DNA contains – Control regions such as promoters and enhancers – Unique noncoding DNA – Repetitive DNA – Found in centromeres and telomeres – Found dispersed throughout the genome, related to transposable element ...
PPT - wFleaBase
PPT - wFleaBase

... length. Insufficient. (FL_alt_splice_flag; 0) Stitched EST lacks compatibility with preexisting protein annotations; invalid and no alt-splice template available. Applied to Dappu1_FM5_196379,0 >asmbl_7600-based protein MSFIILLCLVAFASAAPQRAAVRVLQLDPVCLLPPVADPTQNCNNFSI… ...
Slides Here
Slides Here

... Reversal Edit Distance • Goal: Given two permutations, find the shortest series of reversals that transforms one into another • Input: Permutations p and s • Output: A series of reversals r1,…,rt transforming p into s, such that t is minimum • t - reversal distance between p and s • drev(p, s) - sm ...
Promoter identification
Promoter identification

... a well-defined sites. However, transcription of many protein-coding genes has been shown to begin at any one of multiple possible sites over an extended region 20–200 bp long. As a result, such genes give rise to mRNAs with multiple alternative 5’ ends. These are housekeeping genes, they do not cont ...
Karyotype, ploidy, and gene dosage
Karyotype, ploidy, and gene dosage

... have been obtained, and the large duplication mnDp37 appears to duplicate almost all of LGIII (Table 1). Some of the other autosomal trisomies (for LGI, LGII and LGV) may possibly be viable, but no explicit crosses designed to generate them have yet been reported. Table 1. Large free duplications. T ...
Slides
Slides

... Chromosome 21: Public vs Celera Assemblies ...
Mendel`s experiments: Mendel`s conclusions
Mendel`s experiments: Mendel`s conclusions

... that are passed on to descendents unchanged (these units are now called genes) An individual inherits one such unit from each parent for each trait A trait may not show up in an individual but can still be passed on to the next generation. In this experiment, the starting parent plants were homozygo ...
Laws of Heredity -Single Gene Disorders
Laws of Heredity -Single Gene Disorders

... that are passed on to descendents unchanged (these units are now called genes) An individual inherits one such unit from each parent for each trait A trait may not show up in an individual but can still be passed on to the next generation. In this experiment, the starting parent plants were homozygo ...
Chromosomes and inheritance
Chromosomes and inheritance

... colorblindness (ONE from each parent). Why is it that the sons could be more prone to colorblindness? He must inherit (receive) only ONE recessive allele. This is due to there being no gene for color vision on the Y chromosome. ...
The making of the Fittest: Natural Selection and Adaptation
The making of the Fittest: Natural Selection and Adaptation

10/16 - link
10/16 - link

... genetically diverse humans. For example, over 600 recent transposon insertions were identified by examining DNA resequencing traces from 36 genetically diverse humans. ...
Researching causes of schizophrenia: methodological madness
Researching causes of schizophrenia: methodological madness

... have revealed further interesting information about the nature of genes themselves • For example, Idaghdour et al, 2008, conducted a study on Moroccan Amazighs (Berbers): • http://www.plosgenetics.org/article/info:doi/ 10.1371/journal.pgen.1000052 • They demonstrated that genetic change was caused b ...
Gibson Assembly™ – Building a Synthetic Biology Toolset
Gibson Assembly™ – Building a Synthetic Biology Toolset

... It is almost twice as large as the synthetic M. genitalium genome reported in 2008, and more than an order of magnitude larger than any reported DNA sequence synthesized outside JCVI. What has been learned in this “proof of concept” experiment can now be applied to designing and producing new organi ...
epigenetics
epigenetics

... Activity: Analyzing Amino Acid Sequences to Determine Evolutionary Relationships ...
Homologous Chromosomes
Homologous Chromosomes

... _____________ w/in a species (genetic recombination) ...
Answers
Answers

... Remember, you may have called the genes something different – that’s OK- it’s the grouping that is important. ...
Chapter 14
Chapter 14

... 14.20 The cro Repressor Is Needed for Lytic Infection ...
Protein Interactions Limit the Rate of Evolution of
Protein Interactions Limit the Rate of Evolution of

... Our goals are twofold: (1) to examine the patterns of coevolution between individual proteins that comprise the working units of the photosynthetic apparatus in cyanobacteria and (2) to understand the factors that may have shaped the genome ‘‘landscape’’ in these photosynthetic prokaryotes. In this ...
Understanding human disease via randomized mice
Understanding human disease via randomized mice

... • Identify genes that contribute to common human diseases. ...
Molecular Evolution
Molecular Evolution

... In a comparison of 74 non-essential genes with 64 essential ones, the rate of substitution was found not to correlate with the severity of the knockout phenotype. To account for differences in function, Hurst and Smith (1999) restricted their analysis exclusively to neuron-specific genes, which hav ...
Nature of Sex Chromosomes
Nature of Sex Chromosomes

... proved harmful - it resulted in males without necessary genes formerly found on the X chromosome  Females were found with unnecessary or even harmful genes previously only found on the Y chromosome.  As a result, genes beneficial to males assembled near the sex-determining genes in order to make t ...
Problem Set 3
Problem Set 3

... round peppers. F1 plants were then test crossed to ggdd plants and the following progeny plants were produced: Phenotype Number green, wrinkled ...
< 1 ... 204 205 206 207 208 209 210 211 212 ... 555 >

Minimal genome

The concept of minimal genome assumes that genomes can be reduced to a bare minimum, given that they contain many non-essential genes of limited or situational importance to the organism. Therefore, if a collection of all the essential genes were put together, a minimum genome could be created artificially in a stable environment. By adding more genes, the creation of an organism of desired properties is possible. The concept of minimal genome arose from the observations that many genes do not appear to be necessary for survival. In order to create a new organism a scientist must determine the minimal set of genes required for metabolism and replication. This can be achieved by experimental and computational analysis of the biochemical pathways needed to carry out basic metabolism and reproduction. A good model for a minimal genome is Mycoplasma genitalium, the organism with the smallest known genome. Most genes that are used by this organism are usually considered essential for survival; based on this concept a minimal set of 256 genes has been proposed.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report