• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Sex-omics - Florida State University College of Medicine
Sex-omics - Florida State University College of Medicine

... We identified 12 core DEGs that have sex-specific differential gene expression in the hippocampus of males and females. A) Venn diagram of the sex-specific DEGs that overlap between the different strains. The genes that overlap in all strains make up a sub-set of the core DEGs (PWD is not shown due ...
Pairwise Alignments Part 1
Pairwise Alignments Part 1

... V T + +L+ W+ QTKQDLELPKLAGTWHSMAMA-TNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWEN 81 ...
Powerpoint file - revised
Powerpoint file - revised

... Half-life of most mRNAs is short (on the order of a few minutes). ...
alleles in gene pair are identical
alleles in gene pair are identical

... 2) Each parent must be contributing a form of a gene to the offspring. • The two alleles in a gene pair can • Gene pairs are described in be: two ways: 1) identical or 1) homozygous: alleles in gene pair are identical Pure 2) different breeding plants are • For example, a gene pair which homozygous ...
Comment on: Resistance gene naming and
Comment on: Resistance gene naming and

... We welcome the letter of Evans,1 which begins the conversation on resistance gene nomenclature in reply to our recent call for rationalization.2 Evans1 agrees that change is needed, but questions the cut-off of ≥2% difference at the DNA (and protein) level for assigning a new number as it ‘would lea ...
Genetic Diseases
Genetic Diseases

... more than females because they only have on X chromosome ...
Genetics PowerPoint - Ms. Melissa King Math and Science
Genetics PowerPoint - Ms. Melissa King Math and Science

... To test the particulate hypothesis, Mendel crossed truebreeding plants that had two distinct and contrasting traits—for example, purple or white flowers. What is meant by “true breeding?” ...
Our material on phylogenetics in bioinformatics was roughly divided
Our material on phylogenetics in bioinformatics was roughly divided

... Can learn a lot from trees – almost never interested in the tree itself as the end product, but what we can learn from the tree. ...
Whole Genome Scale DNA Methylation Differences in
Whole Genome Scale DNA Methylation Differences in

... results to the other methods and only required 200 ng DNA. To date we have 10 paired samples of thymus thymocytes and stromal cells. Conclusion: These results suggest that changes in DNA methylation represented by T1D-MVPs must arise very early in the etiological process that leads to overt T1D. The ...
STRs and Marker Analysis
STRs and Marker Analysis

... Judy’s doctor believes that the cases of breast cancer in Judy’s family are consistent with hereditary cancer. Because both males and females are affected, and because there are no cases of ovarian cancer, the doctor suspects a mutation in the BRCA2 gene. ...
Chapter 13: Patterns of Inheritance
Chapter 13: Patterns of Inheritance

... 3. Pairs of alternative forms among progeny 4. Characteristic Mendelian Ratio of segregation is B. Mendel's Model 1. Parents transmit factors that provide information about traits 2. Each individual contains factors for each trait a. May code for same form or alternative forms ...
Finding Disease Genes
Finding Disease Genes

... the protein product of the gene. Such genes usually produce large amounts of well-known and studied proteins. Gene-specific oligonucleotides: hemophilia A Factor VIII gene. The most common form of hemophilia, Xlinked. ...
Section 9 – Human therapeutics and forensic uses
Section 9 – Human therapeutics and forensic uses

... DNA can be used to identify criminals with incredible accuracy when biological evidence exists. Still not used to convict people for a long time as juries didn’t understand how the DNA evidence proved anything. Samples could be contaminated easily. ...
Biology
Biology

... 3) Extra Y chromosome in males 4) Extra x chromosome in female Q31. An anther has only four Sporogenous cells , the number of pollen grains will be: ...
Chapter 4 Extensions of Mendelism
Chapter 4 Extensions of Mendelism

... Allelic Variation and Gene Function Gene Action: From Genotype to Phenotype Inbreeding: Another Look at Pedigrees ...
Divining Biological Pathway Knowledge from High
Divining Biological Pathway Knowledge from High

... The node NRAS has an edge connecting it to MAPK1, BRAF and MAPK signaling pathway – All those nodes are “neighbors” of NRAS ...
From DNA to Protein WS
From DNA to Protein WS

... f. portions of DNA where the double helix separates during DNA replication g. a five-carbon sugar h. consists of a phosphate group, a sugar molecule, and a nitrogen base i. a nitrogenous base that forms hydrogen bonds with adenine j. a class of organic molecules, each having a single ring of carbon ...
Lecture 15 Genetic Regulation
Lecture 15 Genetic Regulation

... A Role for Minerals in Genetic Expression Summary: Metal ions are not passive components of biological systems as once thought. Recent studies have shown that Fe, Cu, or Zn are capable of regulating the expression of genes that code for that metal’s storage or transport proteins ...
Prokaryotic genomes
Prokaryotic genomes

... and fragments with sizes between 1.6 and 2.0 kb purified from an agarose gel and ligated into a plasmid vector to produce a clone library. End sequences were obtained from clones taken from this library, and a computer used to identify overlaps between sequences. This resulted in 140 sequence contig ...
FanBLM2
FanBLM2

... Using feature selection technique to make the network learning task more robust and with less computational cost. Learning gene regulatory networks on microarray dataset with disease labels(thus we may find pathways relevant to specific disease). Using ICA to finding hidden variables(hidden layers) ...
DNA Structure and Function
DNA Structure and Function

... opens up along a gene 2. RNA nucleotides (A,U,C,G) match up and join the open DNA strand 3. The complete RNA strand is released and moves to the cytoplasm ...
human-genome-project
human-genome-project

... http://www.sanger.ac.uk/HGP/overview.shtml U.S. Department of Energy Genome Programs, Genomics and Its Impact on Science and Society, 2003 ...
Document
Document

... representing an approximate reduction of 15 years from the general population. Six of 32 women had renal failure, 9 of 32 (28%) died of cerebrovascular complications, and 42 (70%) had experienced neuropathic pain. Twenty (30%) female patients had some serious or debilitating manifestation of Fabry d ...
Examples of Gene flow File
Examples of Gene flow File

... Gene flow is the exchange of genes between two separate populations. This is most often accomplished when animals or spores from plants migrate to a new area. Any time a gene is introduced into a population where that gene once did not exist, gene flow has occurred. ...
Nature v. Nurture
Nature v. Nurture

... chromosomes, for a total of 46. Twenty-two of these pairs, called autosomes, look the same in both males and females. The 23rd pair, the sex chromosomes, differ between males and females. Females have two copies of the X chromosome, while males have one X and one Y chromosome. ...
< 1 ... 1039 1040 1041 1042 1043 1044 1045 1046 1047 ... 1482 >

Gene



A gene is a locus (or region) of DNA that encodes a functional RNA or protein product, and is the molecular unit of heredity. The transmission of genes to an organism's offspring is the basis of the inheritance of phenotypic traits. Most biological traits are under the influence of polygenes (many different genes) as well as the gene–environment interactions. Some genetic traits are instantly visible, such as eye colour or number of limbs, and some are not, such as blood type, risk for specific diseases, or the thousands of basic biochemical processes that comprise life.Genes can acquire mutations in their sequence, leading to different variants, known as alleles, in the population. These alleles encode slightly different versions of a protein, which cause different phenotype traits. Colloquial usage of the term ""having a gene"" (e.g., ""good genes,"" ""hair colour gene"") typically refers to having a different allele of the gene. Genes evolve due to natural selection or survival of the fittest of the alleles.The concept of a gene continues to be refined as new phenomena are discovered. For example, regulatory regions of a gene can be far removed from its coding regions, and coding regions can be split into several exons. Some viruses store their genome in RNA instead of DNA and some gene products are functional non-coding RNAs. Therefore, a broad, modern working definition of a gene is any discrete locus of heritable, genomic sequence which affect an organism's traits by being expressed as a functional product or by regulation of gene expression.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report