• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
ArrayExpress and Expression Atlas
ArrayExpress and Expression Atlas

... What is functional genomics (FG)? • The aim of FG is to understand the function of genes and other parts of the genome ...
Relatedness of penicillin-resistant Streptococcus
Relatedness of penicillin-resistant Streptococcus

... was completely different from those of all the other strains (Fig. 1, Table 2). Likewise the profile of strain 801 is very different. This is not surprising since this strain is derived directly from strain R6 and shares the same restriction profile (data not shown). R6 is itself a non-capsulated ty ...
Lesson B: What Can Pseudogenes Tell Us About Common Ancestry
Lesson B: What Can Pseudogenes Tell Us About Common Ancestry

Kinetic MoDiversity of Hydrocarbon-Related Catabolic Genes in Oil
Kinetic MoDiversity of Hydrocarbon-Related Catabolic Genes in Oil

... several steps. Many studies have already demonstrated the existence of large and diverse populations of microbes with different metabolic activities in petroleum systems [5,6]. Nonetheless, knowledge of the diversity of catabolic genes involved in the processes of degradation of oil is still scarce. ...
Mutation detection using whole genome sequencing
Mutation detection using whole genome sequencing

... Variant not seen in sequencing reads of both directions Variant seen in germline of another patient Number of novel starts for reads supporting variant is low Position of variant in relation to repetitive sequences ...
SNPLecturesHomework2014
SNPLecturesHomework2014

... chr14:66165219..66205218) that was discussed in class and using the recipes find a set of 5 tag-SNPs that could be used for association analysis in this region. Paste these into your report (basically use recipe 6 to accomplish what was done for the BRCA2 locus. Do any of the SNPs correspond to the ...
Sequence analysis and expression of the M1 and M2 matrix protein
Sequence analysis and expression of the M1 and M2 matrix protein

... quite hydrophilic. An analogous region of the M1 protein of VHSV also showed significant variation among strains of the virus as noted by Benmansour et al. (1994). In the central portion of the M1 proteins of HIRRV and IHNV there was a highly conserved region (amino acids 108 to 147) where 39 of 40 ...
Phylogenetic relationships among iguanian lizards using alternative
Phylogenetic relationships among iguanian lizards using alternative

ESTs to genome
ESTs to genome

... Alters the RNA sequence encoded by DNA in a single-nucleotide, site-specific, ...
comparing quantitative trait loci and gene expression data
comparing quantitative trait loci and gene expression data

... adopted the embedded conversion tool in Expressionview (Fischer et al, 2003) to estimate physical distances from cM. The “smoothing window” technique used in Expressionview essentially applies the idea of piecewise regression. However at the edge of chromosomes and some middle places where possibly ...


... BLAST hits between N. crassa and the other species. Orthologous naming has certain advantages. It provides immediate evidence for evolutionary conservation of sequence and makes it simpler for researchers to consider the potential function of the gene in N. crassa. Yet, naming an ortholog by the nam ...
Lecture 19
Lecture 19

Implementation and Compliance Issues
Implementation and Compliance Issues

... Access to genetic resources is subject to the prior informed consent of the country where such resources are located and to mutually agreed terms regarding the sharing of benefits which could be derived from such access. The international regime under development is intended to provide the internati ...
Green Revolution Genes
Green Revolution Genes

... When suitable dwarf lines are not available it is common practice to control stem growth by treating with growth retardants, which inhibit enzymes in the GA-biosynthetic pathway (see Web Topic 20.1). In fact, Rht wheat is often treated with chlormequat (CCC) to obtain further dwarfing when necessary ...
Figure S5.
Figure S5.

... ...
wg: Use primers wg550F and wgABRZ with cycler profile ST
wg: Use primers wg550F and wgABRZ with cycler profile ST

... Bembidarenas reicheellum #1 (specimen 2213). Our unpublished data suggests that Bembidarenas setiventre is quite distantly related to B. reicheellum #2, and likely not congeneric, whereas Bembididarenas reicheellum #1 is possibly (although unlikely) conspecific. Although one is more distant than our ...
Transposable elements, genes and recombination in a 215
Transposable elements, genes and recombination in a 215

... a genome designated Am that is closely related to the genome of T. urartu, the A genome donor for tetraploid and hexaploid wheats. The large genome of T. monococcum (1C =5600 Mb; Bennett and Leitch 1995) is approximately 12 times larger than the genome of rice and 40 times larger than the genome of ...
msb4100030-sup
msb4100030-sup

... Expression profiles of 53 proliferation cluster genes with cell cycle periodicity (CCP) index > 3 during three cell cycles of HeLa cells (Whitfield et al. 2002) (another 45 proliferation cluster genes for which expression data exists in the cell cycle experiment had CCP<3 (not shown). In black are c ...
Supplementary Legends
Supplementary Legends

... different colors indicating the mutation type (i.e. C>A, C>G, C>T, T>A, T>C and T>G). The height of colored bars represents the fraction of mutations attributed in each of the 96 sub-bins. (b) Genetic alterations that would result in the bi-allelic inactivation (i.e. two mutations in the same gene, ...
PPT - wFleaBase
PPT - wFleaBase

... length. Insufficient. (FL_alt_splice_flag; 0) Stitched EST lacks compatibility with preexisting protein annotations; invalid and no alt-splice template available. Applied to Dappu1_FM5_196379,0 >asmbl_7600-based protein MSFIILLCLVAFASAAPQRAAVRVLQLDPVCLLPPVADPTQNCNNFSI… ...
Synthetic Interactions
Synthetic Interactions

... Dudely AM. Janse DM. Tanay A. Shamir R. Church GM. A global View of Pleiotropy and Phenotypically Derived Gene Function in Yeast Molecular Systems Biology 2005 ...
Chapter 15 Outline - Adelphi University
Chapter 15 Outline - Adelphi University

... Chapter 15 Outline Genes and How They Work Advanced Placement Biology Roslyn High School The Central Dogma Traces The Flow Of Gene-Encoded Information. How Do Cells Use RNA To Make Protein? ...
Bio1100 Ch15W
Bio1100 Ch15W

... Results of chromosome errors • Homozygous embryos with a large ___________ normally die • A deletion in the X chromosome is ____________in males • A _______________________________ can alter phenotype because a gene’s expression is influenced by its location. Example- Leukemia is due to a growth ge ...
Variations from Mendel`s original Crosses
Variations from Mendel`s original Crosses

... •It is often difficult to locate actual _____________ due to the randomness of _________________, which can change (albeit slightly) all the time. •Scientists have tried using recombination maps to compare __________. The more closely related the species, the more _______________ their chromosome ma ...
Three subunits of the RNA polymerase II
Three subunits of the RNA polymerase II

... cyclin C-dependent kinase. These two proteins were also recently shown to be subunits of the RNA polymerase II mediator complex (11,13). It should be noted that one of our gig2 complementing plasmids encodes a truncated kinase in which the 56 C-terminal residues are missing. This shows that that the ...
< 1 ... 137 138 139 140 141 142 143 144 145 ... 342 >

Pathogenomics

Pathogen infections are among the leading causes of infirmity and mortality among humans and other animals in the world. Until recently, it has been difficult to compile information to understand the generation of pathogen virulence factors as well as pathogen behaviour in a host environment. The study of Pathogenomics attempts to utilize genomic and metagenomics data gathered from high through-put technologies (e.g. sequencing or DNA microarrays), to understand microbe diversity and interaction as well as host-microbe interactions involved in disease states. The bulk of pathogenomics research concerns itself with pathogens that affect human health; however, studies also exist for plant and animal infecting microbes.
  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report