Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Protein: FCGR3A [Homo sapiens (Human)] Accession AAH17865. CD16a antigen, Fc-gamma RIIIa, FcGR3, FcGR3A, IgG Fc receptor III-2, CD16a Sequence: GLY17-GLN208 GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAY SPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYR CQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPI HLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYI PKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVS TISSFFPPGYQGGGHHHHHH Figure 1: SEC-HPLC Analysis of FCGR3A Host: CHO cell Characterization: Molecular Mass:22.6 kDa, 4050 kDa on SDS PAGE due to glycosylation Purity: >97% monomer by SDS-PAGE and HPLC SEC after IMAC-Ni and SEC purification Endotoxin Level: < 0.5 EU/mg Activity: ELISA and Western blot Formulation: 5-10 mg/mL FCGR3A in 10 mM MES 25 mM NaCl pH 6.0 Shipping: Liquid with ice packs Stability and Storage: receptor is stable at 2-8 °C for more than 30 days and more than a year at -80 °C Figure 2: SDS-PAGE Analysis of FCGR3A: Lane M: Protein Marker Lane 1: Reducing Conditions Lane 2: Non-reducing conditions