Survey
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Appendix 30 Objectives EVALUATION OF CROSS-PROTECTION BETWEEN O1 MANISA AND O1 CAMPOS IN CATTLE VACCINATED WITH O1 MANISA VACCINES V.A.Srinivasan1*, S.B.Nagendrakumar1, M.Madhanmohan1, S.Yuvaraj1, S.Parida2, Antenello di Nordo2, D.J.Paton2, 1 Indian Immunologicals Limited, Rakshapuram, Gachibowli Post, Hyderabad 500 019, India 2 Pirbright Laboratory, Institute for Animal Health, Ash Road, Woking, Surrey GU24 0NF, UK [email protected] • Serology is used to predict vaccine induced protection against challenge with a heterologous strain of the same serotype of foot-and-mouth disease virus (FMDV) • To evaluate the accuracy of such predictions the protection afforded to cattle vaccinated with different payloads of the O1 Manisa strain of FMDV against challenge with either a homologous (O1 Manisa) or a heterologous strain (O1 Campos) was compared (FP6 grant SSPE-CT-2003-503603). • Serology by virus neutralization test (VNT) using O1 Manisa antiserum predicted an acceptable protection (r1 = 0.60) against such a challenge Experimental Design • Oil adjuvant monovalent vaccines with O1 Manisa (2ml/dose) were prepared with the following payloads – – – – 0.94 µg 3.75 µg 15 µg 60 µg • Preparation of cattle challenge viruses – O1 Manisa – O1 Campos • Cattle challenge studies using modified potency test – Homologous potency test using blends 15, 3.75 and 0.94µg – Heterologous potency test using blends 60, 15, 3.75 µg Results of percentage protection against homologous challenge with O1 Manisa on 21 dpv in cattle calves vaccinated with different payloads of O1 Manisa vaccine Experiment 1 Experiment 2 Groups Payload (μg) Group 2 15 8 8 100 5 5 100 Group 4 3.75 8 8 100 5 5 100 Group 6 0.94 8 7 88 5 1 20 Group 8 UV Control 8 0 0 2 0 0 Number Number Percentage Number Number Percentage Challenged Protected Protection Challenged Protected Protection “New tools and challenges for progressive control” Open Session of the EuFMD Research Group, Vienna (Austria) 29 September ‐ 1 October 2010 Appendix 30 Results of percentage protection against heterologous challenge with O1 Campos on 21 dpv in cattle calves vaccinated with different payloads of O1 Manisa vaccine Experiment 1 Experiment 2 Number Number Percentage Challenged Protected Protection Number Number Percentage Challenged Protected Protection Groups Payload (μg) Group 1 60 8 6 75 5 5 100 Group 3 15 8 4 50 5 3 60 Group 5 3.75 7 2 29 5 0 0 Group 7 UV Control 8 0 0 2 0 0 Serum antibody response towards O1 Manisa vaccine in animals challenged with (a) O1 Manisa and (b) O1 Campos Experiment 1 Mean rectal temperature in vaccinated and control animals Homologous challenge Homologous challenge Experiment 2 Mean of copy numbers of FMDV detected at 5, 10, 15, 21 and 35 days post-challenge by quantitative RT-PCR with different Ag payloads used for homologous (a) and heterologous (b) challenge. Error bars represent 95% CI. “New tools and challenges for progressive control” Open Session of the EuFMD Research Group, Vienna (Austria) 29 September ‐ 1 October 2010 Appendix 30 Scatter plot of O1 Manisa serological responses at 21 days post-vaccination and proportion protected against homologous and heterologous challenge with fitted lines for the RTO models and corresponding 95% CIs. Data from both experiment 1 and 2 were included to plot the graphs. Scatter plot of O1 Campos a serological responses at 21 days post-vaccination and proportion protected against homologous and heterologous challenge with fitted lines for the RTO models and corresponding 95% CIs. Data from both experiment 1 and 2 were included to plot the graphs. PA50 for O1 Manisa with O1 Manisa VNT results: 0.963 PA50 for O1 Campos with O1 Manisa VNT results: 1.741 PA50 for O1 Manisa with O1 Campos VNT results: 0.879 PA50 for O1 Campos with O1 Compos VNT results: 1.771 Probit probability analysis of serum antibody titers for PA50 values PA50 for O1 Manisa: 0.879 Probit probability analysis of antigen payload for PD50 values PD50 for O1 Manisa: 0.92 mcg/dose PA50 for O1 Campos: 1.739 PD50 for O1 Campos: 32.2 mcg/dose B cell epitopes in 1D region Sequence identities of the O1 Manisa viruses used in vaccine production, cattle challenge test and neutralisation test OMANISA69 TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHT O1CAMPOS55 TTSAGESADPVTTTVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILDLMQIPSHT OMANISA69 LVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYT O1CAMPOS55 LVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKGLDNTTNPTAYHKAPLTRLALPYT 9 T P P P P P P VP4 40 D D D E E E E OMANISA69 O1CAMPOS55 KRAETYCPRPLLAIHPDQARHKQKIVAPVKQLL KRAETYCPRPLLAIHPTEARHKQKIVAPVKQTL BHK7 BHKCZ Cattle Passage 1 Cattle Passage 2 Affected cattle - 3930 Feet Epithelium Amino acid Position OMANISA69 APHRVLATVYNGNCKYGDGTVANVRGDLQVLAQKAARALPTSFNYGAIKATRVTELLYRM O1CAMPOS55 APHRVLATVYNGECRYSRNAVPNVRGDLQVLAQKVVRTLPTSFNYGAIKATRVTELLYRM O1MANISA69 [AJ251477] Cattle challenge virus Capsid Protein 61 N N N K K K K 139 A A A P P P P 163 S S S P P P S 57 P R R P P P P 137 G V V V V V V VP2 Examination of the B-cell epitopes in the 1D region show perceptible differences VP1 No changes were noticed in VP2 region “New tools and challenges for progressive control” Open Session of the EuFMD Research Group, Vienna (Austria) 29 September ‐ 1 October 2010 Appendix 30 Sequence identities of the O1 Campos viruses used in vaccine production, cattle challenge test and neutralisation test Capsid Protein Comparison of r1 values for protection against heterologous challenge r1 values Protected Not Protected Total % Protection <0.19 2 2 4 50.00 A 0.20-0.39 2 1 3 66.67 A A 0.40-0.70 5 4 9 55.56 A A A 0.71-1.00 4 3 7 57.14 A A A >1 9 6 15 60.00 Amino acid Position O1CAMPOS58 [AJ320488] BHK5 BHK6 Cattle Passage 1 Cattle Passage 2 Cattle challenge virus Affected cattle - 4167 Feet Epithelium 4 A A A V V V 13 T T A A A 97 G G A A 156 V V A A VP1 No changes were noticed in VP4, VP2 and VP3 regions Mean Protection Comparison of serum antibody titres for protection against heterologous challenge ≤ Titres Based on O1 Manisa titres Protected Not Protected Total % Protection 0.61 1.00 0.00 1.00 100.00 0.91 0.00 1.00 1.00 1.21 0.00 2.00 2.00 1.51 1.00 5.00 1.81 7.00 6.00 2.11 4.00 2.00 2.41 4.00 2.71 2.00 3.01 1.00 57.87 Comparison of serum antibody titres for protection against heterologous challenge ≤ Titres Based on O1 Campos titres Protected Not Protected Total % Protection 0.61 1.00 1.00 2.00 50.00 0.00 0.91 0.00 1.00 1.00 0.00 0.00 1.21 2.00 1.00 3.00 66.67 6.00 16.67 1.51 2.00 7.00 9.00 22.22 13.00 53.85 1.81 4.00 5.00 9.00 44.44 6.00 66.67 2.11 2.00 2.00 4.00 50.00 1.00 5.00 80.00 2.41 5.00 1.00 6.00 83.33 1.00 3.00 66.67 2.71 3.00 0.00 3.00 100.00 0.00 1.00 100.00 3.01 1.00 0.00 1.00 100.00 Mean protection 52.63 Interpretations Mean protection 52.63 Interpretations • The two experiments produced almost similar results. • Vaccine containing the highest payload of 60 µg could offer only partial protection (75%) in Expt 1 where as in Expt II it was 100%. • Post-challenge generalization of the disease was noticed in all but one unvaccinated control animal. • Vaccines containing the payload of 15 µg could offer only 50-60% protection. • FMD-NSP antibodies could be detected from all the control animals until day 35 post challenge except in case of two animals in the homologous challenge group. • Hence the results confirm that there is only partial cross protection for O1 Campos in animals vaccinated with O1 Manisa • Viral RNA/virus could be detected intermittently from the control animals up to day 35 post-challenge in most of the animals. • To achieve cross protection O1 Manisa pay load must be very high or possibly a repeat vaccination with the optimal payload may offer protection (to be confirmed by further studies) • Two control animals each in homologous and heterologous challenge did not show virus RNA/virus on day 35 post challenge. “New tools and challenges for progressive control” Open Session of the EuFMD Research Group, Vienna (Austria) 29 September ‐ 1 October 2010 Appendix 30 Interpretations • NSP antibody response was noticed in most of the animals indicating virus replication in both the experiments • Virus was not isolated from the probang samples in any of the vaccine groups. • However, viral RNA could be detected from one animal in all the O1 Manisa challenged groups and one each in two O1 Campos challenged groups (60 and 3.75 µg) by qRT-PCR. • The Log PA50 values for serum antibody tires for O1 Manisa was 0.879 while that for O1 Campos was 1.739 • The PD50 values for antigen payload for O1 Manisa was 0.92 mcg/dose while that for O1 Campos was 32.2 mcg/dose. Thank you Acknowledgements "The research leading to these results have received funding from the European Community's Seventh Framework Programme (FP7/2007-2013) under grant agreement n° 226556" “New tools and challenges for progressive control” Open Session of the EuFMD Research Group, Vienna (Austria) 29 September ‐ 1 October 2010