Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Mark Gerstein, Yale University bioinfo.mbb.yale.edu/mbb452a 1 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu BIOINFORMATICS Introduction Biological Data + Computer Calculations 2 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Bioinformatics • (Molecular) Bio - informatics Bioinformatics is conceptualizing biology in terms of molecules (in the sense of physical-chemistry) and then applying “informatics” techniques (derived from disciplines such as applied math, CS, and statistics) to understand and organize the information associated with these molecules, on a large-scale. • Bioinformatics is a practical discipline with many applications. 3 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu What is Bioinformatics? What is the Information? Molecular Biology as an Information Science DNA -> RNA -> Protein -> Phenotype -> DNA • Molecules Sequence, Structure, Function • Processes Mechanism, Specificity, Regulation • Central Paradigm for Bioinformatics Genomic Sequence Information -> mRNA (level) -> Protein Sequence -> Protein Structure -> Protein Function -> Phenotype • Large Amounts of Information Standardized Statistical •Most cellular functions are performed or facilitated by proteins. •Primary biocatalyst •Cofactor transport/storage •Mechanical motion/support •Genetic material •Information transfer (mRNA) •Protein synthesis (tRNA/mRNA) •Some catalytic activity •Immune protection •Control of growth/differentiation (idea from D Brutlag, Stanford, graphics from S Strobel) 4 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu • Central Dogma of Molecular Biology Molecular Biology Information - DNA Coding or Not? Parse into genes? 4 bases: AGCT ~1 K in a gene, ~2 M in genome atggcaattaaaattggtatcaatggttttggtcgtatcggccgtatcgtattccgtgca gcacaacaccgtgatgacattgaagttgtaggtattaacgacttaatcgacgttgaatac atggcttatatgttgaaatatgattcaactcacggtcgtttcgacggcactgttgaagtg aaagatggtaacttagtggttaatggtaaaactatccgtgtaactgcagaacgtgatcca gcaaacttaaactggggtgcaatcggtgttgatatcgctgttgaagcgactggtttattc ttaactgatgaaactgctcgtaaacatatcactgcaggcgcaaaaaaagttgtattaact ggcccatctaaagatgcaacccctatgttcgttcgtggtgtaaacttcaacgcatacgca ggtcaagatatcgtttctaacgcatcttgtacaacaaactgtttagctcctttagcacgt gttgttcatgaaactttcggtatcaaagatggtttaatgaccactgttcacgcaacgact gcaactcaaaaaactgtggatggtccatcagctaaagactggcgcggcggccgcggtgca tcacaaaacatcattccatcttcaacaggtgcagcgaaagcagtaggtaaagtattacct gcattaaacggtaaattaactggtatggctttccgtgttccaacgccaaacgtatctgtt gttgatttaacagttaatcttgaaaaaccagcttcttatgatgcaatcaaacaagcaatc aaagatgcagcggaaggtaaaacgttcaatggcgaattaaaaggcgtattaggttacact gaagatgctgttgtttctactgacttcaacggttgtgctttaacttctgtatttgatgca gacgctggtatcgcattaactgattctttcgttaaattggtatc . . . . . . caaaaatagggttaatatgaatctcgatctccattttgttcatcgtattcaa caacaagccaaaactcgtacaaatatgaccgcacttcgctataaagaacacggcttgtgg cgagatatctcttggaaaaactttcaagagcaactcaatcaactttctcgagcattgctt gctcacaatattgacgtacaagataaaatcgccatttttgcccataatatggaacgttgg gttgttcatgaaactttcggtatcaaagatggtttaatgaccactgttcacgcaacgact acaatcgttgacattgcgaccttacaaattcgagcaatcacagtgcctatttacgcaacc aatacagcccagcaagcagaatttatcctaaatcacgccgatgtaaaaattctcttcgtc ggcgatcaagagcaatacgatcaaacattggaaattgctcatcattgtccaaaattacaa aaaattgtagcaatgaaatccaccattcaattacaacaagatcctctttcttgcacttgg 5 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu • Raw DNA Sequence Molecular Biology Information: Protein Sequence ACDEFGHIKLMNPQRSTVWY but not BJOUX Z • Strings of ~300 aa in an average protein (in bacteria), ~200 aa in a domain • ~200 K known protein sequences d1dhfa_ d8dfr__ d4dfra_ d3dfr__ LNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQ-NLVIMGKKTWFSI LNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQ-NAVIMGKKTWFSI ISLIAALAVDRVIGMENAMPWN-LPADLAWFKRNTL--------NKPVIMGRHTWESI TAFLWAQDRDGLIGKDGHLPWH-LPDDLHYFRAQTV--------GKIMVVGRRTYESF d1dhfa_ d8dfr__ d4dfra_ d3dfr__ LNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQ-NLVIMGKKTWFSI LNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQ-NAVIMGKKTWFSI ISLIAALAVDRVIGMENAMPW-NLPADLAWFKRNTLD--------KPVIMGRHTWESI TAFLWAQDRNGLIGKDGHLPW-HLPDDLHYFRAQTVG--------KIMVVGRRTYESF d1dhfa_ d8dfr__ d4dfra_ d3dfr__ VPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHP VPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAVYKAAMEKP ---G-RPLPGRKNIILS-SQPGTDDRV-TWVKSVDEAIAACGDVP------EIMVIGGGRVYEQFLPKA ---PKRPLPERTNVVLTHQEDYQAQGA-VVVHDVAAVFAYAKQHLDQ----ELVIAGGAQIFTAFKDDV d1dhfa_ d8dfr__ d4dfra_ d3dfr__ -PEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHP -PEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTAVYKAAMEKP -G---RPLPGRKNIILSSSQPGTDDRV-TWVKSVDEAIAACGDVPE-----.IMVIGGGRVYEQFLPKA -P--KRPLPERTNVVLTHQEDYQAQGA-VVVHDVAAVFAYAKQHLD----QELVIAGGAQIFTAFKDDV 6 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu • 20 letter alphabet Molecular Biology Information: Macromolecular Structure Almost all protein (RNA Adapted From D Soll Web Page, Right Hand Top Protein from M Levitt web page) 7 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu • DNA/RNA/Protein Molecular Biology Information: Whole Genomes Fleischmann, R. D., Adams, M. D., White, O., Clayton, R. A., Kirkness, E. F., Kerlavage, A. R., Bult, C. J., Tomb, J. F., Dougherty, B. A., Merrick, J. M., McKenney, K., Sutton, G., Fitzhugh, W., Fields, C., Gocayne, J. D., Scott, J., Shirley, R., Liu, L. I., Glodek, A., Kelley, J. M., Weidman, J. F., Phillips, C. A., Spriggs, T., Hedblom, E., Cotton, M. D., Utterback, T. R., Hanna, M. C., Nguyen, D. T., Saudek, D. M., Brandon, R. C., Fine, L. D., Fritchman, J. L., Fuhrmann, J. L., Geoghagen, N. S. M., Gnehm, C. L., McDonald, L. A., Venter, J. C. (1995). "Wholegenome random sequencing and assembly of Haemophilus influenzae rd." Genome sequence now Science 269: 496-512. accumulate so quickly that, (Picture adapted from TIGR website, in less than a week, a single http://www.tigr.org) laboratory can produce • Integrative Data more bits of data than 1995, HI (bacteria): 1.6 Mb & 1600 genes done Shakespeare managed in a 1997, yeast: 13 Mb & ~6000 genes for yeast lifetime, although the latter 1998, worm: ~100Mb with 19 K genes make better reading. Small, K. V., Fraser, C. M., Smith, H. O. & 1999: >30 completed genomes! 2003, human: 3 Gb & 100 K genes... -- G A Pekso, Nature 401: 115-116 (1999) 8 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu • The Revolution Driving Everything Young/Lander, Chips, Abs. Exp. Brown, Botstein marray, Rel. Exp. over Timecourse Also: SAGE; Samson and Church, Chips; Aebersold, Protein Expression Snyder, Transposons, Protein Exp. 9 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Gene Expression Datasets: the Transcriptome Yeast Expression Data in Academia: levels for all 6000 genes! Can only sequence genome once but can do an infinite variety of these array experiments at 10 time points, 6000 x 10 = 60K floats telling signal from background (courtesy of J Hager) 10 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Array Data • Affymetrix • Oligos • Glass slides Pat brown 11 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu microarrays Systematic Knockouts Winzeler, E. A., Shoemaker, D. D., Astromoff, A., Liang, H., Anderson, K., Andre, B., Bangham, R., Benito, R., Boeke, J. D., Bussey, H., Chu, A. M., Connelly, C., Davis, K., Dietrich, F., Dow, S. W., El Bakkoury, M., Foury, F., Friend, S. H., Gentalen, E., Giaever, G., Hegemann, J. H., Jones, T., Laub, M., Liao, H., Davis, R. W. & et al. (1999). Functional characterization of the S. cerevisiae genome by gene deletion and parallel analysis. Science 285, 901-6 2 hybrids, linkage maps Hua, S. B., Luo, Y., Qiu, M., Chan, E., Zhou, H. & Zhu, L. (1998). Construction of a modular yeast twohybrid cDNA library from human EST clones for the human genome protein linkage map. Gene 215, 143-52 For yeast: 6000 x 6000 / 2 ~ 18M interactions 12 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Other WholeGenome Experiments • Information to understand genomes Metabolic Pathways (glycolysis), traditional biochemistry Regulatory Networks Whole Organisms Phylogeny, traditional zoology Environments, Habitats, ecology The Literature (MEDLINE) • The Future.... (Pathway drawing from P Karp’s EcoCyc, Phylogeny from S J Gould, Dinosaur in a Haystack) 13 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Molecular Biology Information: Other Integrative Data GenBank Growth Year 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 GenBank Data Base Pairs Sequences 680338 606 2274029 2427 3368765 4175 5204420 5700 9615371 9978 15514776 14584 23800000 20579 34762585 28791 49179285 39533 71947426 55627 101008486 78608 157152442 143492 217102462 215273 384939485 555694 651972984 1021211 1160300687 1765847 2008761784 2837897 3841163011 4864570 8604221980 7077491 14 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Large-scale Information: Internet Hosts As important as the increase in computer speed has been, the ability to store large amounts of information on computers is even more crucial (Internet picture adapted from D Brutlag, Stanford) Num. Protein Domain Structures Structures in PDB • Driving Force in Bioinformatics 1979 1981 1983 1985 1987 1989 1991 4500 4000 3500 3000 2500 2000 1500 1000 500 0 1980 1993 1995 140 120 100 80 60 40 20 0 1985 1990 1995 CPU Instruction Time (ns) • CPU vs Disk & Net 15 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Large-scale Information: Exponential Growth of Data Matched by Development of Computer Technology The Next Step after the sequence: Proteomics Expression Analysis Structural Genomics, Protein Interactions Step 1: The genome sequence and genes Pseudogenes, Regulatory Regions, Repeats Evolutionary Implications of Intergenic Regions as Gene Graveyard 16 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Comprehensive Understanding of Gene Function on a Genomic Scale 17 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu The next step: • Different Sequences Have the Same Structure • Organism has many similar genes • Single Gene May Have Multiple Functions • Genes are grouped into Pathways • Genomic Sequence Redundancy due to the Genetic Code • How do we find the similarities?..... Integrative Genomics genes structures functions pathways expression levels regulatory systems …. 18 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Organizing Molecular Biology Information: Redundancy and Multiplicity “Prediction” Bioinformatics (focused on individual genes and structures) 19 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Integrative Genomic Surveys of Many Proteins vs from Many Perspectives • Understanding How Structures Bind Other Molecules (Function) • Designing Inhibitors • Docking, Structure Modeling (From left to right, figures adapted from Olsen Group Docking Page at Scripps, Dyson NMR Group Web page at Scripps, and from Computational Chemistry Page at Cornell Theory Center). 20 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Major Application I: Designing Drugs Fold Recognition Docking & Drug Design Protein Geometry Protein Flexibility Secondary Structure Prediction Homology Modeling Function E-literature ClassSequence ification Expression Alignment Clustering Database Design Gene Large-Scale Prediction Structure Classification Genome Annotation Genomic Surveys 21 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu Bioinformatics Subtopics • (Molecular) Bio - informatics Bioinformatics is conceptualizing biology in terms of molecules (in the sense of physical-chemistry) and then applying “informatics” techniques (derived from disciplines such as applied math, CS, and statistics) to understand and organize the information associated with these molecules, on a large-scale. • Bioinformatics is a practical discipline with many applications. 22 (c) Mark Gerstein, 1999, Yale, bioinfo.mbb.yale.edu What is Bioinformatics?