Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
High light response in Arabidopsis thaliana 4 days 1100 transcripts change Low light High light Anthocyanin light response mutant Mutant characterisation by metabolite profiling • Targeted analysis of anthocyanins and other flavonoids (MRM). • What else is different? – Run samples (wild type v. mutant HL v. LL) on LC-QToF. – Identify potential compounds in each sample using molecular feature extraction (MFE) in MassHunter: ~3000 “compounds”. – Align features (mass/retention time pairs) across samples (Perera-Yang method). – Statistical analysis to identify differentially expressed features. • Check MFE data to confirm. • Identify features from accurate mass/isotope abundance and MS/MS spectra. • Use m/z, retention time and MS/MS data to set up specific assays by MRM using QQQ. Total ion chromatograms of 4 samples Extracted ion chromatograms (EIC) from one sample Molecular feature extraction- identifies “compounds” by amalgamating charge states and adducts with the same chromatographic retention time. Extracted compounds aligned across samples and compared. Hierarchical clustering compares abundance of compounds in mutant and WT plants grown in low and high light Extracted compounds aligned across samples and compared. Hierarchical clustering compares abundance of compounds in mutant and WT plants grown in low and high light Protein abundance – VTC2 MLKIKRVPTVVSNYQKDDGAEDPVGCGRNCLGACCLNGARLPLYACKNLVKSGEKLVISHEAIEPPVAFL ESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFT KVGQEELLFQFEAGEDAQVQFFPCMPIDPENSPSVVAINVSPIEYGHVLLIPRVLDCLPQRIDHKSLLLAV HMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTVSGVKISELLSYPVRSLLFE GGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQCYAEKQALGEVSPEVLETQVNPAVWEIS GHMVLKRKEDYEGASEDNAWRLLAEASLSEERFKEVTALAFEAIGCSNQEEDLEGTIVHQQNSSGNVN QKSNRTHGGPITNGTAAECLVLQ* counts precursor ion product ions acquisition time (mins) Protein abundance – VTC2 in vitro translation with labelled amino acid (e.g. 13C-Leu*) * * * * * Detect mass difference between labelled and unlabelled protein precursor ions TRYPSIN * * * * * FRAGMENTATION * * * detect by mass spectrometry * product ions • Spike plant extracts with a known quantity of labelled VTC2 • Directly compare abundance with VTC2 present in leaf extract • Spike plant extracts with multiple biosynthetic proteins – simultaneous quantification Unlabelled glutamate (Glu) and glutamine (Gln) Abundance 1600 1400 Glu 1200 Gln 1000 800 600 400 200 0 0 20 40 60 80 100 120 140 Tim e after adding 15NH3 (m in) 15N-labelled Glu and Gln 3000 2500 Abundance 2000 15N-Glu 1500 15N-Gln (1) 15N-Glu (2) 1000 500 0 0 20 40 60 80 100 120 -500 m e after adding 15NH3 (m inTim e after adding 15NH3 (m in) 140