Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Product Datasheet ABCG5 Antibody NBP1-80712 Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. www.novusbio.com [email protected] Publications: 1 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NBP1-80712 Updated 3/1/2016 v.20.1 Page 1 of 3 v.20.1 Updated 3/1/2016 NBP1-80712 ABCG5 Antibody Product Information Unit Size 0.1 ml Concentration Clonality Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal Preservative 0.02% Sodium Azide Isotype IgG Purity Immunogen affinity purified Buffer PBS, pH 7.2, containing 40% glycerol Storage Product Description Host Rabbit Gene ID 64240 Gene Symbol ABCG5 Species Human Species Reactivity Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%) Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against Recombinant Protein corresponding to amino acids:IHQPRSELFQLFDKIAILSFGELIFCGTPAEMLDFFNDCGYPCPEHSNPFD FYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMV PFKTKDSPGVFSKLGVLL Specificity/Sensitivity Immunogen Product Application Details Applications Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 Application Notes For HIER pH6 retrieval is recommended. Images Immunohistochemistry: ABCG5 Antibody [NBP1-80712] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. www.novusbio.com [email protected] Page 2 of 3 v.20.1 Updated 3/1/2016 Publications Ahn Sang Bong, Jang Kiseok, Jun Dae Won et al. Expression of liver X receptor correlates with intrahepatic inflammation and fibrosis in patients with nonalcoholic fatty liver disease. Dig Dis Sci. 2014 Aug 08 [PMID: 25102981] (Human) www.novusbio.com [email protected] Novus Biologicals USA Novus Biologicals Canada 8100 Southpark Way, A-8 Littleton, CO 80120 USA Phone: 303.730.1950 Toll Free: 1.888.506.6887 Fax: 303.730.1966 [email protected] 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: 905.827.6400 Toll Free: 855.668.8722 Fax: 905.827.6402 [email protected] Novus Biologicals Europe General Contact Information 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) 1235 529449 )UHH3KRQH0800 37 34 15 Fax: (44) (0) 1235 533420 [email protected] www.novusbio.com Technical Support: [email protected] Orders: [email protected] General: [email protected] Products Related to NBP1-80712 NBP1-80712PEP ABCG5 Protein HAF008 NB7160 Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-Rabbit IgG Secondary Antibody [HRP] AB-105-C Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our guarantee, please visit www.novusbio.com/guarantee. www.novusbio.com [email protected]