Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
SunnyTALEN: a second-generation TALEN system for human genome editing Ning Sun, Zehua Bao, Xiong Xiong and Huimin Zhao Supplementary Method TALEN construction The central repeat units of TALEs were assembled by the Golden Gate reactions as previously described (Cermak et al. 2011). The receiver plasmids pCMV5-GG-WT for WT TALEN and pCMV5-GG-Sunny for the SunnyTALEN scaffold are available upon request. The NTS and CTS of the GoldyTALEN scaffold were PCR-amplified from pC-GoldyTALEN plasmid (Kindly provided by Dr. Daniel Carlson from University of Minnesota, Minneapolis, MN). SURVEYOR nuclease assay HEK293 cells in 6-well plates were harvested 48 h after transfection. Genomic DNA was extracted using Wizard Genomic DNA Purification Kit (Promega, Madison, WI) according to the manufacturer’s instructions. DNA fragments containing TALEN target sites were PCRamplified from the genomic DNA using the primers described previously (Reyon et al. 2012). Gel-purified PCR products were re-annealed slowly and analyzed by SURVEYOR Mutation Detection Kits (Transgenomic, Omaha, NE) according to the manufacturer’s instructions. The product was resolved on a 2% agarose gel stained with GelStar (Lonza, Rockland, ME). The bands were quantified by G Box using Gene Tools software (Syngene, Frederick, MD). The apparent indel percentage of the original cell pool was calculated using the following equations as previously described (Guschin et al. 2010): Fraction cleaved = volume of cleaved bands/(volume of cleaved bands + volume of uncleaved bands) % Indels = 100 × (1- (1- Fraction cleaved)1/2) H2AX phosphorylation assay HEK293 cells were cultured in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% FBS. Cells were seeded in 12-well plates (2×105 per well) and transfected after 24 h with 500 ng of each TALEN expression plasmid, 1 μg empty pCMV5 vector as a negative control or 1 μg reported toxic ZFN construct GZF3N (kindly provided by Dr. Toni Cathomen of Hannover Medical School, Hannover, Germany) as a positive control. After 48 h post transfection, cells were harvested, fixed, permeabilized, and stained using the H2AX phosphorylation assay kit (Millipore, Watford, UK) according to the manufacturer’s protocol. Cells were then scanned in a flow cytometer to quantitate the number of cells staining positive for phosphorylated histone H2AX. Sequencing analysis of endogenous gene mutations HEK293 cells in 6-well plates were harvested 48 h after transfection with SunnyTALEN expression plasmids. Genomic DNA was extracted using Wizard Genomic DNA Purification Kit 1 (Promega, Madison, WI) according to the manufacturer’s instructions. DNA fragments containing TALEN target sites within the BRCA2 gene were PCR-amplified from the genomic DNA using the primers KpnI-BRCA2-for 5’-act gac ggt acc tga tct tta act gtt ctg ggt cac aaa-3’ (KpnI recognition site shown in italics) and SalI-BRCA2-rev 5’-act gac gtc gac cgc cag gga aac tcc ttc ca-3’ (SalI recognition site shown in italics). DNA fragments containing TALEN target sites within the SS18 gene were PCR-amplified from the genomic DNA using the primers KpnISS18-for 5’-act gac ggt acc ggg atg cag gga cgg tca ag-3’ (KpnI recognition site shown in italics) and SalI-SS18-rev 5’-act gac gtc gac gcc gcc cca tcc cta gag aaa-3’ (SalI recognition site shown in italics). PCR products corresponding to the two sites were cloned into pCMV5 plasmid between KpnI and SalI restriction sites. Plasmid DNA was isolated from 20 colonies for each transformation and then sent for Sanger sequencing using the primer pSeq-pCMV5-for 5’-cgc aaa tgg gcg gta ggc gtg-3’. An eGFP gene conversion assay The eGFP gene was divided into two fragments by insertion of a preselected sequence from the HBBS gene locus and an in-frame stop codon. The non-functional eGFP reporter stably integrated into the genome of Hela cells as previously described (Sun et al. 2012). A donor plasmid was constructed by insertion of a promoter-less eGFP gene with the first 37 nucleotides missing into the pNEB193 plasmid (New England Biolabs, Beverly, MA) as previously decribed (Sun et al. 2012). The donor plasmid provides a homologous DNA segment as a template for repairing the double-stranded break in the eGFP reporter. The reporter Hela cells were maintained in modified Eagle’s medium (MEM) supplemented with 10% Fetal Bovine Serum (FBS; Hyclone, Logan, UT). Cells were seeded in 12-well plates at a density of 1×105 per well. After 24 hr, reporter cells were co-transfected with a certain amount of TALEN expression plasmids and 500 ng of donor plasmid using FuGene HD transfection reagent (Promega, Madison, WI) under conditions specified by the manufacturer. Cells were trypsinized from their culturing plates 48h after transfection and resuspended in 300 μL phosphate buffered saline (PBS) for flow cytometry analysis. 20,000 cells were analyzed by BD LSRII flow cytometer (BD Biosciences, San Jose, CA) to determine the percentage of eGFP-positive cells. Computational modelling The homology models of TALEs with 63 aa CTSs were created by the I-TASSER online server (Zhang 2008) based on the crystal structure of dHax3 (PDB accession code: 3V6P) (Deng et al. 2012). The DNA-bound models were created based on the crystal structure of DNA-bound dHax3 (PDB accession code: 3V6T) (Deng et al. 2012) and energy minimized using the Molecular Operating Environment (MOE, The Chemical Computing Group, 2008) software package. The figures were generated using UCSF Chimera (Pettersen et al. 2004). 2 Supplementary Table 1. Recognition sequences of TALENs. The TALE binding sites are highlighted. Target site AvrXa10 HBBS ABL1 APC BRCA2 CCND1 CCR5 ERCC2 FH MYC PTEN SDHC SS18 XPA Recognition sequence TATATAAGCACGTATCTTCTAGGATAGGACTAAAGATACGTGCTTATATA TAGCAACCTCAAACAGACACCATGGTGCATCTGACTCCTGTGGAGAAGTCTGCCGTTA TACCTATTATTACTTTATGGGGCAGCAGCCTGGAAAAGTACTTGGGGACCAA TATGTACGCCTCCCTGGGCTCGGGTCCGGTCGCCCCTTTGCCCGCTTCTGTA TTAGACTTAGGTAAGTAATGCAATATGGTAGACTGGGGAGAACTACAAACTA TGGAACACCAGCTCCTGTGCTGCGAAGTGGAAACCATCCGCCGCGCGTACCCCGA TGCTGGTCATCCTCATCCTGATAAACTGCAAAAGGCTGAAGAGCATGACTGACA TCCGGCCGGCGCCATGAAGTGAGAAGGGGGCTGGGGGTCGCGCTCGCTA TGTACCGAGCACTTCGGCTCCTCGCGCGCTCGCGTCCCCTCGTGCGGGCTCCA TGCTTAGACGCTGGATTTTTTTCGGGTAGTGGAAAACCAGGTAAGCACCGAA TCCCAGACATGACAGCCATCATCAAAGAGATCGTTAGCAGAAACAAAAGGA TGTTGCTGAGGTGACTTCAGTGGGACTGGGAGTTGGTGCCTGCGGCCCTCCGGA TGGTGACGGCGGCAACATGTCTGTGGCTTTCGCGGCCCCGAGGCAGCGAGGCA TGGGCCAGAGATGGCGGCGGCCGACGGGGCTTTGCCGGAGGCGGCGGCTTTA 3 Spacer length (bp) 16 15 17 16 16 16 15 16 17 16 16 16 17 16 Supplementary Figure 1. Strategy for the creation of a TALEN mutant library. (A) Schematic depicting random mutagenesis of the CTS and the FokI nuclease domain and assembly of the library of mutants through homologous recombination in yeast. GAL10p, promoter of GAL10 gene; ADH2t, transcription terminator of ADH2 gene; and CEN6, a centromere of yeast chromosome. LEU2 auxotrophic marker is used for selection of transformants in yeast. Asterisks indicate mutagenized CTS and FokI. (B) Sequence and numbering of the CTS and the FokI domain. The CTS is highlighted in magenta. The FokI domain is highlighted in orange. 4 Supplementary Figure 2. Directed evolution of TALENs in the yeast screening system. The columns denote the percentage of eGFP-positive cells in each screening cycle and the induction of TALEN expression was performed in galactose (GAL)-containing medium for certain amounts of time. The arrows indicate the portions of cells that were collected by FACS and applied for the next cycle of screening. 5 Supplementary Figure 3. Representative flow cytometry plots of the TALEN activities in the yeast reporter system. TALEN expression was induced in the culture medium containing 0.02% galactose for 4 h. eGFP-positive cells were quantitated in gates as depicted. Autofluorescence was measured using a phycoerythrin-fluorescence channel. NC, negative control without induction. 6 Supplementary Figure 4. Representative flow cytometry plots of TALEN activities in human cells. Activities were measured in the modified surrogate reporter system (Figure 4A) in a doselimiting condition (32 ng transfected TALEN expression plasmids per 105 cells). eGFP-positive cells were quantitated in gates as depicted. Autofluorescence was measured using a phycoerythrin-fluorescence channel. Empty vector pCMV5 served as negative control. 7 Supplementary Figure 5. Immunofluorescent analysis of TALEN variants, which contain a nuclear localization signal and a FLAG tag at N-terminus (Supplementary Figure 11). Nuclei were stained with DAPI. 8 Supplementary Figure 6. Representative gel images of the SURVEYOR nuclease assay to determine the frequencies of TALEN-induced indels. 9 Supplementary Figure 7. Activities of different TALEN variants in targeting three loci of human genome as measured by SURVEYOR nuclease assay. 10 Supplementary Figure 8. Sequencing analysis of the mutagenesis generated by SunnyTALENinduced NHEJ against BRCA2 and SS18 sites in HEK293 cells. TALEN binding sites are highlighted in yellow. Deleted nucleotides are shown in dashes. Inserted nucleotides are shown in red. BRCA2 5’-TTAGACTTAGGTAAGTAATGCAATATGGTAGACTGGGGAGAACTACAAACTAGGA-3’ Mutated sequences 5’-TTAGACTTAGGTAAGTAATGCAAT----TAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAAT--GGTAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAA---------CTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAAT---G-AGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATA---TAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATA-----GACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAAT---------TGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATAT---A-------------TACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCA-----------------GAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAAT---GTAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATAT---AGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACT---------------------------GGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATA----AGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATA-GGTAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAA------------GACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAATA-------CTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAG--------------ATGGTAGACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCAAT------------------------------A-3’ 5’-TTAGACTTAGGTAAGTAATGC---------GACTGGGGAGAACTACAAACTAGGA-3’ 5’-TTAGACTTAGGTA-------------------CTGGGGAGAACTACAGACTAGGA-3’ 5’-TTAGACTTAGGTAAGTAATGCA-T-T-----ACTGGGGAGAACTACAAACTAGGA-3’ X2 X2 SS18 5’-TGGTGACGGCGGCAACATGTCTGTGGCTTTCGCGGCCCCGAGGCAGCGAGGCAAG-3’ Mutated sequences 5’-TGGTGACGGCGGCAA---------------------------------------G-3’ 5’-TGGTGACGGCGGCAA----------G--TTCGCGGCCCCGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAAC----------CTTTCGCGGCCCCGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAACATGTCTGTG---TT-------CCGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGC-----------------------CCCGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAACATGTCTGTGGGGCTGCTGCTTTCGCGGCCCCGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCA------------------------------ACCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAACATGTCTGTG-CT----------CGAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAAC----------CTTTCGCGGCCCCGAGGCACCCAGGCAAG-3’ 5’-TGGTGACGGCGGCAACATGTCTGTGGCT-----------GAGGCAGCGAGGCAAG-3’ 5’-TGGTGACGGCGGCAACATGTCTGTC--TTTCGCGGCCCCGAGGCAGCGAGGCAAG-3’ 11 Supplementary Figure 9. The SunnyTALEN platform enhanced the efficiency of homologous recombination in human cells. (A) Schematic of an eGFP gene conversion assay in Hela cells. The insertion of a HBBS site (Supplementary Table 1) divided and inactivated the eGFP gene, which was stably integrated into the chromosome. TALEN cleavage induced the homologous recombination mediated by a donor plasmid bearing a promoter-less and non-functional eGFP gene, reconstituting a functional eGFP gene. (B) Dose-response curve using titrations of different TALEN expression plasmids as tested in the eGFP gene conversion assay. Error bars indicate standard deviation of three independent experiments. 12 Supplementary Figure 10. Analysis of off-target effects from WT and SunnyTALEN platforms. (A) A potential off-target site within the HBD gene. Bases differing from the TALEN recognition site against the HBBS locus (underlined) are highlighted in red. (B) SURVEOR nuclease analysis of the potential off-target site within the HBD gene. Low dose indicates 32 ng TALEN expression plasmids were transfected per 105 cells. High dose indicates 256 ng TALEN expression plasmids were transfected per 105 cells. Three independent replicates were shown for each analysis. The cleaved bands were indicated by an arrow. 13 Supplementary Figure 11. Sequence alignment of the GoldyTALEN, WT and SunnyTALEN scaffolds using Clustal Omega (Sievers et al. 2011). The FokI nuclease domains are shown in orange. The CTSs are highlighted in magenta. The NTSs are highlighted in cyan. The SV40 nuclear localization signals are highlighted in yellow. The FLAG tags are highlighted in grey. Goldy WT Sunny MGPKKKRKVAAADYKDDDDK---------------------------------------MGPKKKRKVAAADYKDDDDKLDTSLLDSMPAVGTPHTAAAPAECDEVQSGLRAADDPPPT MGPKKKRKVAAADYKDDDDKLDTSLLDSMPAVGTPHTAAAPAECDEVQSGLRAADDPPPT ******************** Goldy WT Sunny ----------------------SWKDASGWSRVDLRTLGYSQQQQEKIKPKVRSTVAQHH VRVAVTAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTVAQHH VRVAVTAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTVAQHH . .*** ::**************************** Goldy WT Sunny EALVGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDIVGVGKQWSGARALEA EALVGHGFTHAHIVALSQHPAALGTVAVTYQDIIRALPEATHEDIVGVGKQWSGARALEA EALVGHGFTHAHIVALSQHPAALGTVAVTYQDIIRALPEATHEDIVGVGKQWSGARALEA *******************************.** ************************* Goldy WT Sunny LLTDAGELRGPPLQLDTGQLVKIAKRGGVTAMEAVHASRNALTGAPLNSIVAQLSRPDPA LLTEAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNSIVAQLSRPDPA LLTEAGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLNSIVAQLSRPDPA ***:****************:**********:***** ********************** Goldy WT Sunny LAALTNDHLVALACLGGRPAMDAVKKGLPHAPELIRRVNRRIGERTSHRVASRSQLVKSE LAALTNDHLVALACLGGRPALDAVKKGLPHAPELIRRINRRIPERTSHRVAL-KQLVKSE LAALTNDHLVALACLGGRPALDAVKKGLPHAPELIRRINRRIHERTSHRVAL-KQLVKSE ********************:****************:**** ******** .****** Goldy WT Sunny LEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVYGYRGKHLGGSRKP LEEKKSELRHKLKYVPHEYIELIEIARNSTQDRILEMKVMEFFMKVYGYRGKHLGGSRKP LEEKKSELRHKLKYVPHEYIELIEIARNPTQDRILEMKVMEFFMKVYGYRGEHLGGSRKP **************************** **********************:******** Goldy WT Sunny DGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVEENQTRNKHINPNEWWKVYP DGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVEENQTRNKHINPNEWWKVYP DGAIYTVGSPIDYGVIVDTKAYSGGYNLPIGQADEMQRYVEENQTRNKHINPNEWWKVYP ************************************************************ Goldy WT Sunny SSVTEFKFLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVR SSVTEFKFLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVR SSVTEFKFLFVSGHFKGNYKAQLTRLNHITNCNGAVLSVEELLIGGEMIKAGTLTLEEVR ************************************************************ Goldy WT Sunny RKFNNGEINF RKFNNGEINF RKFNNGEINF ********** 14 References Cermak T, Doyle EL, Christian M, Wang L, Zhang Y, Schmidt C, Baller JA, Somia NV, Bogdanove AJ, Voytas DF. 2011. Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res 39(12):e82. Deng D, Yan C, Pan X, Mahfouz M, Wang J, Zhu JK, Shi Y, Yan N. 2012. Structural basis for sequence-specific recognition of DNA by TAL effectors. Science 335(6069):720-3. Guschin DY, Waite AJ, Katibah GE, Miller JC, Holmes MC, Rebar EJ. 2010. A rapid and general assay for monitoring endogenous gene modification. Methods Mol Biol 649:24756. Pettersen EF, Goddard TD, Huang CC, Couch GS, Greenblatt DM, Meng EC, Ferrin TE. 2004. UCSF Chimera--a visualization system for exploratory research and analysis. J Comput Chem 25(13):1605-12. Reyon D, Tsai SQ, Khayter C, Foden JA, Sander JD, Joung JK. 2012. FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol 30(5):460-5. Sievers F, Wilm A, Dineen D, Gibson TJ, Karplus K, Li W, Lopez R, McWilliam H, Remmert M, Soding J, Thompson JD, Higgins DG. 2011. Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega. Mol Syst Biol 7:539. Sun N, Liang J, Abil Z, Zhao H. 2012. Optimized TAL effector nucleases (TALENs) for use in treatment of sickle cell disease. Mol Biosyst 8(4):1255-63. Zhang Y. 2008. I-TASSER server for protein 3D structure prediction. BMC Bioinformatics 9:40. 15