Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Supplemental Figures B 8 µg StuI+SacI 6 NotI std1 4 std1 StuI+SacI 8 XmaI WT NotI WT XmaI A C Con. Acc. Degr. Acc. Degr. WT std1 std1::STD1-1 std1::STD1-2 Figure S1. Southern blot analysis and complementation of the std1 mutant. (A) Southern blot analysis indicates single insertion of the antibiotic resistance cassette in the genome of std1. NotI-, XmaI or StuI/SacI-restricted genomic DNA of wild-type and std1 mutant cells was loaded on an agarose gel, Southern blotted and hybridized with a probe against the AphVIII gene (paromomycin resistance cassette). Loaded amount of DNA per lane is indicated in µg. (B) Vector construct used for the complementation of the std1 mutant. Genomic wild-type DNA coding for STD1 was amplified by PCR and cloned into the pSL-Hyg vector harbouring the psaD promoter and terminator, and a hygromycin resistance marker allowing selection of positive transformants. (C) Starch degradation phenotype of the std1 mutant and of two complemented lines. Intracellular starch levels of wild-type strain (black), std1 mutant (white) and two complemented strains (std1::STD1-1 and -2, grey) were analyzed in response to nutrient deprivation and resupply. Cultures were grown in TAP medium (Con. = Control), subjected for two days to nitrogen (TAP-N) or sulfur starvation (TAP-S), which induced starch accumulation (Acc.). Subsequently, the starved cells were transferred to minimal medium (MM) and kept for 8 or 24 hours in the dark. Starch was catabolized (Degr.) in MM (comprising N but no C) in the dark. Starch values are the means ± SD (n ≥ 3). 1 A CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 DH box 908aa--YHMDEQGNVLYEYDPDYIDRKYEVFELRVIHRRHRTGFEETKDFPIRLNDLIAG 57aa--EDEEDAAVQEHTRRIRAEEEEFETFDLKIIHRKNRTGFEEDKDFPVVINAVVAG 783aa--DDEEAVAVQEQVRQIKAQEEEFETFDLKIVHRKNRTGFEEEKNFNVVLNSVIAG 782aa--EDEEAAAVQEQVRQIKVQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAG 1486aa--EDEEAAAVQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAG 746aa--DDEEAAALQEQVRQIKAQEEEFETFNLKIVHRKNRTGFEEDKNFHVVLNSVIAG 361aa--LKAEEDAETNIDLALSDFHREYEVFELRIIHRKNRTGFEENKDFPIVLNSVVAG 964 413 839 838 1542 802 417 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 I II III RYQVMDFLGSAAFSRAVQALDIKTGQLVCLKIIKNHKDYFDQSLDEIKLLKYVNTMDPND RYHVTEYLGSAAFSKAIQAHDLHTGMDVCMKIIKNNKDFFDQSLDEIKLLKYINKHDPGD RYHVTEYLGSAAFSKAIQAHDLQTGMDVCIKIIKNNKDFFDQSLDEIKLLKYVNKHDPAD RYHVTEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDHAD RYHVTEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKFVNKNDPAD RYHVTEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQSLDEIKLLKYVNKHDPAD RYYITEYLGSAAFSKVVQAHDLRTGMDVCLKIIKNDKDFFDQSLDEIKLLKFVNKYDPLD 1024 473 899 898 1602 862 477 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 IV V VIa EYAIVRLYDFFYYKEHLFLVCELLRANLYEFQKYNKESGDPAYFTNARIQRIARQALRSL KHHLLRLYDYFYHKEHLFIVCELLRANLYEFHKYNRESGGEVYFTMPRLQSIARQCLESL KYHLLRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLESL KYHILRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITTQCLEAL KYHILRLYDYFYYREHLLIVCELLKANLYEFHKFNRESGGEVYFTMPRLQSITIQCLEAL KYHLLRLYDYFYYREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQSIAIQCLEAL EHHVLRLYDYFYHQEHLFIVTELLRANLYEFQKYNQESGGEVYFTLPRIQVIARQCLEAL 1084 533 959 958 1662 922 537 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 VIb VII VIII AFLHSLGLIHSDLKPENILIKSYSRCEVKVIDLGSSCFITDQLSSYVQSRSYRAPEVILG EFIHGLGLIHCDLKPENILVKSYSRCEIKVIDFGSSCFQTDHLFSYVQSRSYRAPEVIVG QFLHGLGLIHCDLKPENILVKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILG QFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSYVQSRSYRAPEVILG QFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCSYVQSRSYRAPEVILG QFLHGLGLIHCDLKPENILVKSYSRCEVKVIDLGSSCFETDHLCAYVQSRSYRAPEVILG VYLHRLRIIHCDLKPENILIKSYSRCEIKVIDLGSSCFLTDNLCLYVQSRSYRAPEVILG 1144 593 1019 1018 1722 982 597 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 IX X LPYDYKVDVWSLGCILAELSSSFVLFQNDSLSTLLARLEGILGPVPEWMLHKGRYAHRFY LPYDQKIDMWSLGCILAELCSGNVLFQNDSLATLLARVVGILGPIDPELLTKGRDTHKFF LPYDKKIDVWSLGCILAELCTGNVLFQNDSPASLLARVMGIVGSFDNEMLTKGRDSHKYF HPYDKKIDVWSLGCILAELCTGNVLFQNDSPATLLARVIGIIGPIDQSMLAKGRDTYKYF LPYDKKIDVWSLGCILAELCTGNVLFQNDSPATLLARVIGIIGSIDQGMLAKGRDTYKYF LPYDKKIDMWSLGCILAELCTGNVLFQNDSPATLLARVMGIIGSIEQAMLAQGRETYKYF LPYDQRIDIWSLGCILSELYTGEVLFPNEPVSVMLAQMIGITGPIDMEMLELGQETQKYF 1204 653 1079 1078 1782 1042 657 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 XI TRSGMLYERNATTQKYDMLQPKRTSLRHRMPDADEGLLEFVGHLLTVDPRKRPTAAEALK TKNHMLYERNQDSDQLEYLLPKKTSLAHRLPMGDKGFVEFVEHLLNINPLLRPTASEALK TKNRMLYERNQESNRLEYLIPKRTSLRHRLPMGDQGFTDFVAHLLEINPKKRPSAAEALK SKNHMLYERNQDTSRLEYLIPKKTSLRHRLPMGDQGFIDFVSHLLEVNPKKRPSASEALK TKNHMLYERNQDTNRLEYLIPKKTSLRHRLPMGDQGFIDFVSHMLEINPKKRPSASEALK TKNHMLYERNQESNRLEYLIPKKTSLRHRLPMADQGFIEFVAYLLEVNPKKRPSASEALK TDDYDLFTENEETDQLEYLIPEKSSLRQHIQCPDSEFVDFLSYLLQINPRKRPTADEALQ 1264 713 1139 1138 1842 1102 717 CrDYRKP1 PpDYRKP1 AtDYRKP1 PtDYRKP4 VvDYRKP1 OsDYRKP2 ZmDYRKP6 HPWLQQEYPSLDSM HPWLSYLYEPISSHPWLSYPYEPISAHPWLSYPYEPISAHPWLSYPYEPISSHPWLSFPYEPISSHPWLSFSY------ 1278 726 1152 1151 1855 1115 B Becker and Joost, 1999 DYRK1 DYRK2 YAK1 DYRKP-A DYRKP-B DYRKP-algae C N N N N N N H X — D/H — X — D/N — R T R T R/K T G Y/F D D D/E G Y D D D G Y/F D D D/E G X D N E G F E E D/E G F E E N G F E E S N N R N K K K X D H/Y D G D/S X D — N/D — D/E — D/E Y X X X X X D/E Y I V K/R N/S G E Y X X V P/L H/G/R D Y/L I L X V N/G/H D/X F H/P/N V V L N S/A F/L P I V X N/D S/T F P V R/K — G/N D DH KINASE CreYak1 AtYak1 CreDYRKP AtDYRKP-1 Figure S2. Conserved sequence features of DYRKP kinases. (A) Alignment of amino acid sequences from the C-terminal kinase domain of Chlamydomonas DYRKP, five higher plant DYRKP homologs and one DYRKP homolog from moss. The sequences were aligned using ClustalW and shaded using BoxShade (http://www.ch.embnet.org). Amino acids 2 highlighted in black are perfectly conserved, and similar residues are indicated by a grey background. Arrows above the alignment indicate the DYRK homology (DH) box that precedes the conserved catalytic kinase domain and the kinase subdomains I-XI according to Aranda et al., 2011. Subdomains I and II respectively harbour the ATP anchor and the phosphate anchor. The catalytic loop is found within subdomain VIb, the cation binding site is located within subdomain VII, and subdomain VIII contains the activation loop and the P+1 loop. The conserved tyrosine in the activation loop (“YxY”) was found to be autophosphorylated and is marked by a triangle. The segment between subdomains X and XI of the protein is known as the CMGC insert. For details see Aranda et al., 2011. (B) Consensus sequence of the DH-box of DYRKs according to (A), additional file 1: Figure S8, Figure S9, and Table S1. Below the published DH consensus sequence from (Becker and Joost, 1999), consensus sequences of DYRK1 (7 sequences), DYRK2 (22 sequences), and Yak1 (21 sequences) are shown. Three minor subgroups were distinguished within the DYRKP subgroup, DYRKP-A (12 land plant sequences including moss), DYRKP-B (11 vascular plant sequences), DYRKP-algae (7 sequences). Multiple sequence alignments of DH-box motifs were performed using the program WebLogo (http://weblogo.berkeley.edu/logo.cgi). (C) Schematic illustration of protein domain organization in two Yak1 and two DYRKP representatives from C. reinhardtii (CreYak1 and CreDYRKP) and A. thaliana (AtYak1 and AtDYRKP-1). DH, DYRK-homology box; Kinase, kinase domain. 3 WT std1::STD1-1 std1 std1::STD1-2 Figure S3. Persistently high starch levels were observed in the std1 mutant during photoautotrophic S deprivation conditions. Intracellular starch was measured in wild-type (black), std1 mutant (white), and complemented lines (grey) during photoautotrophic S deprivation under medium light (100 µmol photons m-2 s-1). Starch values are the means of 5 biological replicates ± SD. 4 A B C D E F G H J WT std1 std1::STD1-1 std1::STD1-2 Figure S4. Total cellular volume data and chlorophyll contents for the kinetic experiments in nitrogen deprivation shown on Figure 2. (A, B, C) Total cellular volume measurements in µm3/ml were recorded by Multisizer™ 3 Coulter Counter® (Beckman). Cells were kept photoautotrophically at low light (LL, 35 µmol photons m-2 s-1) (A) or medium light (100 µmol photons m-2 s-1) (B) supplemented with 2% CO2 (A, B) or mixotrophically (TAP) under medium light (C) as in Figure 2. Values are means ± SD (n ≥ 3). (D, E, F) Chlorophyll contents during N deprivation in photoautotrophic or mixotrophic conditions. Chlorophyll was extracted by methanol, and chlorophyll a and b were determined by measuring the absorbance at 653, 666 and 750 nm using UV-VIS spectrophotometer (SAFAS UVmc2 with the software SP2000). Chlorophyll content was calculated using the formula Concentration (µg/ml) = (A1-A3)*19.71+(A2-A3)*4.44. Chlorophyll concentrations are means ± SD of ≥ 3 experiments, duplicate samples were taken. 5 (G, H, J) Cell or particle concentrations per ml were recorded by Multisizer™ 3 Coulter Counter® (Beckman) as in (A, B, C). WT std1 std1::STD1-1 std1::STD1-2 Figure S5. Oil accumulate in std1 mutant following N deprivation. TAG content in cells grown photoautotrophically under medium light (100 µmol photons m-2 s-1) supplemented with 2% CO2. A representative experiment is shown with means from three technical replicates. 6 Figure S6. The std1 mutant forms cell aggregates enclosed by the mother cell wall. (A) Bright field and differential interference contrast images of wild-type (WT), std1 mutant and complemented (std1::STD1-1 and -2) strains grown in minimal medium (MM) supplemented with 2% CO2 and then subjected to N deprivation for 0, 2 or 6 days. Arrows indicate mother cell walls. Scale bars, 10 µm. (B) Particle numeration (left panels) and total cellular volumes (right panels) as a function of the particle diameter, determined in cultures of WT (red), std1 mutant (green) and two complemented strains std1::STD1-1 (blue) and -2 (black) at 0, 2 or 6 days in MM-N/2% CO2. Data are from the same experiment as in (A). (C, D) Cell counting during nitrogen starvation following treatment with the cell wall-degrading enzyme autolysin. Particle concentration (C) and particle diameter (D) were determined in WT (red), std1 mutant (green) and complemented lines (blue) during nitrogen deprivation in photoautotrophic condition (MM-N/2% CO2). Data are from before (solid lines) and after treatment with autolysin (dashed lines) and represent means ± SD (n = 4). Autolysin treatment allowed determination of std1 cell number during deprivation kinetics (C) and revealed an increase in the volume of each single mutant cell, while the volume of wild-type cells decreased during nutrient starvation (D). 7 A std1 WT 0 1 2 3 0 1 2 3 RbcL Cyt f PsbD PsaC AtpB COXIIb std1 WT B 0 1 2 3 0 1 2 3 250 150 100 75 50 37 25 20 15 10 Figure S7. Protein levels in wild-type and std1 mutant cells during photoautotrophic N deprivation as determined by immunodetection. (A) Provided antibody names include RbcL, Rubisco large subunit; Cyt f, cytochrome f; PsbD, D2 photosystem II subunit; PsaC, PSI-C core photosystem I subunit; AtpB, beta subunit of ATP synthase; and COXIIb, cytochrome oxidase subunit II b. 10 µg of total protein were loaded from N starved cells and harvested at the indicated time points after N depletion. Days in MM-N are indicated. (B) Coomassie brilliant blue coloration. Molecular weight marker units are in kDa. 8 ZmDYRKP-3/4 DYRK1 DYRKP VcaDYRK2 PhypaDYRKP-1/2/3 DYRK2 Yak1 Figure S8. Phylogenetic tree of the DYRK protein family. The complete tree obtained by the Neighbour-Joining (NJ) method as in Figure 1d, before combination of branches from Populus trichocarpa, Zea mays, and two species of Micromonas and Ostreococcus. Bootstrap values are indicated. 9 A DYRKP DYRK2 AtDYRKP-4 OsDYRKP-2 AtDYRKP-1/2 DYRK2/3 dDYRK3 CreDYRKP Phypa DYRK-1/2/3 VcaDYRKP DYRK4 VivDYRKP-1 ChlNCDYRKP VivDYRKP-2 dDYRK2 ChlNC-DYRK2 AtDYRKP-3 MicpuDYRKP OsDYRKP-1 CreDYRK2 VcaDYRK2 OstDYRKP OsDYRKP-3 PhypaDYRK2 MicpuDYRK2 Pom1 Ppk5p DdDYRK2 Minibrain DYRK1B DdDYRK1 DYRK1A DYRK1 YakA Yak1 PhypaYak 1/2/3/4/5 Yak1p AspYak1 B OsYak1/2 MicpuYak1 OstYak1 CreYak1 VcaYak1 Ppk15 VivYak1 AtYak1 DYRKP OsDYRKP-3 OsDYRKP-1 VivDYRKP-2 VcaDYRKP CreDYRKP AtDYRKP-3 ChlNC-DYRKP AtDYRKP-1/2 VivDYRKP-1 OsDYRKP-2 DYRK2 Phypa DYRKP-1/2/3 DYRK2/3 dDyrk3 AtDYRKP-4 Ppk5p MicpuDYRKP OstDYRKP Pom1 DYRK4 dDyrk2 ChlNC-DYRK2 VcaDYRK2 CreDYRK2 MicpuDYRK2 DdDyrk2 DdDyrk1 Minibrain DYRK1A PhypaDYRK2 Dyrk1b DYRK1B YakA DYRK1 Yak1p AspYak1 Ppk15p OstYak1 PhypaYak 1/2/3/4/5 MicpuYak1 CreYak1 VcaYak1 OsYak1/2 Yak1 VivYak1 AtYak1 Figure S9. Phylogenetic tree of the DYRK protein family by using the Maximum Likelihood (ML) or the Parsimony (Pars) approach. Phylogenetic tree obtained by the ML (A) or the Pars (B) method. Branches were combined as displayed in Figure 1d. 10 Table S1. Accession numbers of the sequences used for the phylogenetic tree in Figure 1D. Sequences in grey were not utilized for the alignment. Definitively incomplete gene models are indicated by an asterisk. When the predicted number of amino acids differed between two compared genome databases, the longer version was typically selected. Several genes display different splice variants, e.g. “ZmDYRKP3”, which harbours three transcripts at this locus. For Danio rerio and Xenopus laevis, not all existing DYRK genes were provided for the alignment. Data were obtained from NCBI and the http://rice.plantbiology.msu.edu, following genome websites: http://www.phytozome.org, http://www.arabidopsis.org, http://www.maizesequence.org, http://www.cosmoss.org, http://genome.jgi.doe.gov/. 11 Table S1. Accession numbers of the sequences used for the phylogenetic tree in Figure 1D, continued. Alternative names of gene models: 1LOC_Os02g47410; 2LOC_Os04g51370; 3LOC_Os01g61620; 4 LOC_Os03g51020, AAT77851, GI:50540694; 5LOC_Os05g39080, EEE64022, GI222631890. 12 Table S1. Accession numbers of the sequences used for the phylogenetic tree in Figure 1D, continued. Predictions concerning the subgroup of incomplete gene models (indicated by an asterisk) from Ostreococcus and Micromonas species are difficult due to missing information about the N-terminal part including the DH-box. 13 Table S2. List of primers used in this study. Name Sequence AphORF_For CGAAGCATGGACGATGCGTT Aph_tail3 CGAGACTGCGATCGAACGGACA GSP1 CTGGTGCTGCGCGAGCTGGCCCACGAGGAG GSP2 TGGTTCGGGCCGGAGTGTTCCGCGGCGTT XbaG4forHyg GTCTAGAATGTCGCTCCGCCTGAACCGATG XbaG4RevHyg GTCTAGACTACATGCTGTCGAGCGAGG Std1UTR1 CATAGTGCTCAGCAGGGGACAAGGC Std1P3rev AGCGTGCCAGAGGTTTCGCCGTC Std1FW2 CCGCGGACGGCGAAACCTCTGGCAC G4rev14 GATCTCGTCCAGCGACTGGTCAAAGTAG ACG4_FW3 GCGGATCCGACGAGCAGGGCAACGTGCTG ACG4_Rev1 CGGCAAGCTTCTACATGCTGTCGAGCGAGG Actin_FW AATCGTGCGCGACATCAAGGAGAA Actin_Rev TTGGCGATCCACATTTGCTGGAAGGT 14 Supplemental references Aranda, S., Laguna, A., and de la Luna, S. (2011). DYRK family of protein kinases: evolutionary relationships, biochemical properties, and functional roles. Faseb J 25, 449-462. Becker, W., and Joost, H.G. (1999). Structural and functional characteristics of Dyrk, a novel subfamily of protein kinases with dual specificity. Prog. Nucl. Acid. Res. Mol. Biol. 62, 1-17. 15