Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Recombinant Human Alcohol dehydrogenase class 4 mu/sigma chain(ADH7) Catalog Number: CSB-EP001362HU Product Name: : Recombinant Human Alcohol dehydrogenase class 4 mu/sigma chain(ADH7) Alternative names: Alcohol dehydrogenase class IV mu/sigma chain Catalog Number: : CSB-EP001362HU Could function in retinol oxidation for the synthesis of retinoic acid, a hormone important for cellular differentiation. Medium-chain (octanol) and aromatic (m-nitrobenzaldehyde) Relevance : compounds are the best substrates. Ethanol is not a good substrate but at the high ethanol concentrations reached in the digestive tract, it plays a role in the ethanol oxidation and contributes to the first pass ethanol metabolism. Mol. Weight: : 46kD Product Info : his-Tagged Source: : E.coli derived Image: Purity: : >90%(SDS-PAGE) Storage Buffer: : 20mM Tris-HCl, 0.5M NaCl, pH 8.0,50% glycerol Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDD HVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLC IRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIG AA sequence: : CGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAM AVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVG VPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFK KISEGFELLNSGQSIRTVLTF "Alcohol dehydrogenase of class IV (sigma sigma-ADH) from human stomach. cDNA sequence and structure/function relationships." References: : Farres J., Moreno A., Crosas B., Peralba J.M., Allali-Hassani A., Hjelmqvist L., Joernvall H., Pares X. Eur. J. Biochem. 224:549-557(1994) 1