Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
UNCTAD/ITCD/CLP/Misc.18
81,7('1$7,216&21)(5(1&(2175$'($1''(9(/230(17
&203(7,7,2132/,&<75$'($1'
'(9(/230(17,17+(&20021
0$5.(7)25($67(51
$1'6287+(51$)5,&$&20(6$
THE RELEVANCE OF REGIONAL INTEGRATION,
INTERNATIONAL COOPERATION AND
THE CONTRIBUTION OF COMPETITION POLICY
TO DEVELOPMENT IN COMESA COUNTRIES
81,7('1$7,216
*HQHYD
7KH5ROHRI&RPSHWLWLRQ3ROLF\IRU'HYHORSPHQWLQ*OREDOL]LQJ:RUOG0DUNHWV
127(
The views expressed in this volume are those of the authors and do not necessarily reflect the views of the UNCTAD secretariat.
The designations employed and the presentation of the material do not imply the
expression of any opinion whatsoever on the part of the United Nations secretariat concerning the legal status of any country, territory, city or area, or of its authorities, or
concerning the delimitation of its frontiers or boundaries.
Material in this publication may be freely quoted or reprinted, but acknowledgement is requested, together with a reference to the document number. A copy of the
publication containing the quotation or reprint should be sent to the UNCTAD secretariat.
LL
&217(176
3DJH
3DUW,
3DUW,,
5HJLRQDOVHPLQDURQFRPSHWLWLRQSROLF\WUDGHDQGGHYHORS
PHQW
A.
SUBSTANTIVE CONTRIBUTIONS ...............................................
3
A.
A.
A.
1. Trade and competition policy in the framework of Afri1. can countries
1. %DFNJURXQGSDSHU(&$ .................................................
3
A.
A.
A.
2. Integrating competition policy in the COMESA regional
1. economic cooperation and integration process
1. '60SDPED ..................................................................
19
A.
A.
A.
3. Economic and market structures in COMESA: a busi1. ness perspective
1. 0HEHOR.10XWXNZD ...................................................
23
A.
A.
A.
A.
4.
1.
1.
1.
Impact of legal reforms to enhance productive capacity
and competitiveness in LDCs: competition policy in
Zambia
2OLYHU66DDVD................................................................
25
A.
A.
A.
A.
5.
1.
1.
1.
Ensuring consumer benefits from competition in globalizing markets and creating a competition culture
supportive of development
*HUDOGLQH)RVWHU.............................................................
37
A.
A.
A.
6. Elimination of trade measures in a customs union and
1. their relevance to regional integration
1. -DPHV0DWKLV ..................................................................
47
A.
A.
A.
A.
7.
1.
1.
1.
Competition policy and small open economies: investment, trade and competition policy in developing countries and some implications for COMESA
0DUN:DUQHU...................................................................
51
A.
A.
A.
8. Trade and competition policy in the framework of Afri1. can countries
1. &RUQHOLXV0ZDOZDQGD....................................................
73
A.
A.
A.
9. Practical risks and opportunities for countries creating
1. new competition laws and enforcement agencies
1. 'RQDOG,%DNHU...............................................................
77
B. CONCLUSIONS AND RECOMMENDATIONS .................................
83
1DWLRQDOVHPLQDURQFRPSHWLWLRQODZDQGSROLF\
A.
SUBSTANTIVE CONTRIBUTIONS ...............................................
87
A.
A.
A.
1. The role of competition law and policy in development:
1. the experience of Zambia
1. 1LFKRODV.ZHQGDNZHQD..................................................
87
LLL
A.
A.
A.
2. The development of competition law and policy in
1. Zambia
1. *HRUJH./LSLPLOH .........................................................
89
A.
A.
A.
3. Treatment of mergers and takeovers, including regional
1. and international measures
1. -DPHV0DWKLV ..................................................................
95
A.
A.
4. Towards a positive agenda for multilateral negotiations
1. on competition policy: interests of developing countries
-DPHV0DWKLV..................................................................
99
5. Regional competition policy for COMESA countries
1. and implications of an FTA in 2000
0-0XVRQGD ................................................................
103
A.
A.
LY
3$57 ,
5(*,21$/ 6(0,1$5 2) &203(7,7,21 32/,&<
75$'( $1' '(9(/230(17
7KH5HOHYDQFHRI5HJLRQDO,QWHJUDWLRQ,QWHUQDWLRQDO&RRSHUDWLRQ
DQGWKH&RQWULEXWLRQRI&RPSHWLWLRQ3ROLF\WR'HYHORSPHQW
LQWKH&RPPRQ0DUNHWIRU(DVWHUQ
DQG6RXWKHUQ$IULFDQ&RXQWULHV&20(6$
3DSHUVSUHVHQWHGDWWKH5HJLRQDO&20(6$6HPLQDU
/XVDND=DPELD-XQH
$
68%67$17,9(&2175,%87,216
7UDGHDQGFRPSHWLWLRQSROLF\LQWKHIUDPHZRUNRI$IULFDQ&RXQWULHV
%\WKH(FRQRPLF&RPPLVVLRQIRU$IULFD
Background Pape
6(&7,21,
avoid the development of concentrated market structures
and to promote consumer welfare. Nonetheless, it is acknowledged that while adhering to universally valid principles, competition policy should be applied with flexibility in the light of specific circumstances of individual
countries, and taking into account the need to balance
“consumer welfare” and “efficiency considerations” as
well as the need to win the confidence of the public and
the business community.
,QWURGXFWLRQ
The globalization and liberalization of the world
economy have brought to the forefront the debate on the
issues of fair competition in international trade. The opening up of economies and markets to inward foreign direct
(FDI) and other forms of participation by transnational
corporations (TNCs) can contribute directly towards increasing the of host country markets in that these markets
can now be entered by firms from other countries by establishing affiliates that produce goods and services for
sale within the host country and thereby compete with domestic firms1. Furthermore, TNCs may be better able than
domestic firms in a host country to overcome some of the
cost-related barriers to entry that limit the number of firms
in some industries and thereby result in the collapse of the
domestic based industries.
There is growing realization that anti-competitive
practices can have a negative influence on international
trade. The challenge faced by developed and developing
countries alike is to introduce national policies that will
promote competition. A firm’s competitiveness is essentially a function of the domestic economic environment in
which it operates. However, the deepening structural integration of the world economy and the burgeoning of alliance capitalism are widening the geographical scope for
creating or augmenting firm-specific competencies and
learning experiences2 Several case studies from both developed and developing countries indicate that trade competition is the prime motivation for enterprises to cut
waste, improve production parameters through research
and development (R&D) and innovation, and allocate resources more efficiently in response to market opportunities or threats. The other market structures that may exist in a country include: monopoly, monopolistic
competition and oligopoly.3
The liberalization of foreign direct investment regimes
can lead to contestability of national markets for goods
and services, since it means that foreign firms are now
free to establish operations in the host country and compete at a level playing field with domestic firms. The entry
of TNCs can therefore influence the structure of host
country markets that evolve for the products in which they
operate. The rise of transnational corporations in international production and trade has given rise to fears of possible concentration of market power in the hands of these
entities and also the possibility of formation of “international cartels.” Furthermore, the globalization and liberalization of world trade has also given rise to a new problem for developing countries: that of dumping excess
outputs of subsidized products produced in the developed
countries on the markets of developing countries. This development threatens to kill basic manufacturing in developing countries.
The basic premise for a country adopting competition
policy and law is that it will give rise to a more efficient
allocation and utilization of resources and promote consumer welfare through “competitive price” for goods and
services. In a “perfectly competitive market structure”
there are many, many buyers and sellers and each firm
produces a good that is identical to that produced by other
firms (Alan Hochstein, 1993). The conditions needed for
Foreign direct investment into developing countries
and transitional economies has usually had extensive effects in either increasing or reducing competition, as well
as in increasing efficiency, in those product markets
where it concentrates. The need, therefore, to control “restrictive business practices” is generally acknowledged.
Countries have often adopted competition laws in order to
2
John H. Dunning, the Geographical Sources of the Competitiveness of Firms; TNC, December 1996.
3
A monopoly market structure is one in which there are many,
many buyers, but only firm selling the product that has very few close
subsidies; an oligopolistic market structure is one in which there are
many, many buyers, but only a few sellers and if the firms in the industry produces a standardized (homogenous) product the market is called
“pure oligopoly” and if their product is more heterogeneous, it is
called a “ differentiated oligopoly”. See Alan Hochstein: Microeconomics, An Advanced Introduction, Thomposon Educational Publishing Inc., 1993. It is the desire by countries to minimize monopolistic
and oligopolistic market structures that provides the impetus for adopting competition policy and law.
1
United Nations Conference on Trade and Development
(UNCTAD): World Investment Report: Transnational Corporations,
Market Structure and Competition, 1997, pp. 134-135
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
such a market structure to prevail include: the existence of
a market price that is charged by all firms in the market;
every buyer has to be perfectly knowledgeable as to the
products produced by each firm and the selling price of
each firm’s output; entry and exit from the market should
not be restricted; and any firm considering entry can do so
and should be able to sell as much as it can at the going
market price. This is indeed, the ideal situation that would
ensure that “competitive prices” prevail.
In order to improve competitiveness of their economies, many African countries have embarked on economic reforms, and in many cases this has entailed a shift towards a “market eocnomy”. These reforms have often not
only involved decontrol of prices, but also liberalization
of foreign exchange markets and movement towards market determined exchange rates and interest rates, privatization of state owned enterprises, and reduced government intervention in private sector economic activity.
The need for African countries to improve competitiveness of their economies in order to effectively participate in a globalizing and liberalizing world economy is
now fully recognized. However, over-facile assumptions
that deregulation, particularly trade liberalization, will always lead to more competition should be avoided. Trade
liberalization does indeed often lead to greater competition, but not always because products in some sectors may
not be tradeable (particularly, services). The reasons
some commodities may not be tradeable may include:
high -transport costs, shortage of foreign exchange, foreclosure of distribution channels, and anti-competitive
practices by foreign exporters.
The aim of competition policy should be to ensure that
the benefits of the removal of governmental restrictions
are not reduced by private restriction upon competition.
Countries can promote competitiveness of their national economics by ensuring that firms do not indulge in “restrictive business practices”, public enterprises do not
crowd out the private sector, and government policies do
not bestow monopolistic or oligopolistic powers on certain firms and also do not reward rent-seeking enterprises
at the expense of productive investment. Government
policies which may contribute to anti-competitive behaviour by firms may include: restrictive entry to certain industries; bestowing monopoly rights to certain firms;
selective allocation of foreign exchange and credit rationing; multiple exchange rates and interest rates; and restrictive marketing arrangements for certain products and
inputs, especially through the creation of marketing
boards.
African countries have made significant progress to
liberalize their economies and improve competitiveness
of these economies. Many have eliminated and/or reduced price controls on a range of products and inputs, except in some cases for strategic commodities such as fuel.
A number have also liberalized their foreign exchange
markets and moved to remove exchange controls for current account transactions and shifted to market-based exchange rate regimes. Credit rationing and allocation have
also been eliminated in a number of countries and some
African countries have moved to market-determined
interest rates.
A number of African countries have also made significant efforts in the more difficult areas of “privatization of
public enterprises” and in dismantling monopoly power
of “marketing boards” in the purchase and marketing of
agricultural products and inputs. The belief of many African countries at the advent of independence was that public enterprises were an important channel for African
Governments to “carve a stake” in African economies and
to ensure some form of ownership of their economies. Accordingly, these enterprises were designed to play a pivotal role in the development process of African countries.
Experience has shown that these good intentions have not
been satisfactorily fulfilled as public enterprises became a
serious burden on budgets of many African Governments
and were crowding-out the private sector. Instead of contributing to development, many became centers of concentration of market power, with disastrous effects on
competitiveness—of African economies. Privatization of
public enterprises in Africa is therefore designed not only
to improve efficiency of operation of these entities, but
more importantly to unleash market forces which will
result in a more efficient allocation and utilization of
resources.
African countries in deciding on their competition
policy and law ought to avoid over-emphasis on deregulation as a panacea to all the problems of African economies. It is essential also to emphasize “regulatory reform.” African governments need indeed to disengage
from direct intervention in economic activity and. from
distorting competition, through the granting of exclusive
rights, etc. Nonetheless, disengaging from direct intervention in economic activity does not absorb the government from its responsibility to act as the referee to ensure
liberalized markets work properly and to assist enterprises through, information, training, and infrastructural
development. Competition policy itself is a form of regulation.
The purpose of this paper is to contribute to the ongoing debate on competition policy and law, with particular focus on African economies. Section II will deal with
the “conceptual framework of competition policy.” Section III will highlight the 1mportance and the role of competition policy”. Section IV will review both, the “evolution of competition policy and law” as it has emerged at
the nation region and multilateral levels and “some African country experiences”. Section V will deal with the
“constraints on competition in Africa” and Section VI
contains “concluding remarks”.
A better understanding of existing competition policy
and law in African countries will not only assist African
countries to be better informed of the discussions taking
place at the multilateral level, such as within the framework of UNCTAD and the WTO, but more importantly
assist those countries that are in the process of adopting
competition policy and law. The study is also intended to
assist African countries in appreciating the importance of
developing “open market structures” and avoiding “anticompetitive practices”, elements essential for the development of a dynamic private sector.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
6(&7,21,,
quently abuse their dominant positions and charge unduly
high prices.
7KHFRQFHSWXDOIUDPHZRUNRIFRPSHWLWLRQSROLF\
Discussions on Competition Policy and Law have
tended to center on: identifying “common ground” in the
approaches followed on different competition questions
by Governments; exchange of views in areas where
“identification of common ground” is more difficult, such
as the role competition policy should play in the strengthening and improvement of economies of developing
countries and countries in transition. The discussions in
this regard have focused on, the development of the business community in those countries; identification and
adoption of appropriate measures to help those countries
that might be hampered by restrictive business practices
(RBPs); the interface between competition policy, technological innovation and efficiency, the competition
policy treatment of vertical restraints and abuses of dominant position; the competition policy treatment of exercise of intellectual property rights and of licenses of intellectual property rights and know-how. Furthermore, focus
has also centred on analysis of differences in the scope of
competition laws in individual sectors, in the light of the
process of economic globalization and liberalization; and
analysis of the effectiveness of enforcement of competition laws, including enforcement in cases of RBPs having
effects in more than one country.7
Competition in a market refers to rivalry among sellers
and among buyers of goods or services; the sellers and
buyers that can enter the contest constitute the market.
The extent and nature of market competition is considered
important in determining the performance of economic
systems and under “static conditions” performance is
judged in terms of efficiency which has two elements:
technical efficiency which exists when the production and
distribution of goods take place with minimum inputs,
given technological constraints; and allocative efficiency,
which exists when resources are allocated in the optimal
manner.4 The great majority of real world situations fall
between “perfect competition” and “monopoly” and
involve imperfect, but workable competition.5
Competition policy seeks to promote competition
through the liberalization of governmental policies and
measures where they unduly distort competition. Competition policy is also concerned with the enforcement of
rules of the game to ensure that enterprises do not undertake restrictive business practices and many Governments
have attempted to ensure incumbent firms do not take advantage of liberalization to “privatize” governmental restraints and bloc market entry.6 Competition allows the
market to reward good performance and penalize poor
performance by producers. It encourages entrepreneurial
activity, stimulates efficiency and market entry by new
firms, and encourages production of a greater variety of
products of good quality. Many governments have taken
into account to ensure that the principles of competition
policy are taken into account when developing and implementing other governmental policies.
Confusion may exist between “trade policy” and
“competition policy”, although competition policy may
aim at making trade policy work better in a framework in
which the principles of competition policy are adhered to.
Competition policy authorities may have an advocacy
role vis-à-vis trade authorities. This does not nonetheless,
imply that the two policies are the same. Competition
policy can make a substantial contribution to improved
trading environment. In Africa, a major handicap for the
development of African economies has been the poor infrastructure which has heightened the cost of both imports
and exports. An inevitable solution to this problem is to
try and find ways of reducing these transport costs. A possible solution would be to inject some form of competitiveness in this sector, through granting of concessions or selling off to the private sector ports, construction
of roads, utilities, etc. Competition policy can help to
work out what would be the best method of going about
this, and also ensure that the private firms do not subse-
D 1DWLRQDODQGLQWHUQDWLRQDOFRPSHWLWLYHQHVV
Competition policy can be analyzed at two levels: the
country level (firm competitiveness) and, at international
level (cross-country competitiveness). Issues that are
addressed in this paper are drawn from the notion of international competitiveness. As defined by the American
Commission on Industrial Competitiveness, a country’s
competitiveness is the ability to produce goods and services that meet the test of international markets and
simultaneously to maintain and expand the real income of
its citizens (Tyson 1992; Ostry 1991).8
From the above definition, a country’s competitiveness
must be judged not only against its performance in the
world market but also in terms of its capacity to sustain
economic growth over a period of time. This is the reason
why such countries as Germany, Japan, Korea, and several other East Asian economies appear as strong competitors.9At firm level, a firm is considered competitive if it is
able to sustain earnings over time and can be viewed as a
strong competitor if it is able to increase both its market
share and. its earnings.10
Although to a large extent firm performance in the
market place is what determines a country’s overall economic strength, nonetheless, it also appears that certain
national characteristics, such as: how human capital is
used, the technical skills of the labour force, managerial
7
4
United Nations Conference on Trade and Development
(UNCTAD): Transnational Corporations, Market Structure and Competition, 1997.
5
The 2 extremes of Perfect Competition and Monopolistic markets
are respectively explained in para. 5 footnote 3.
6
United Nations Conference on Trade and Development
(UNCTAD): op cit.
UNCTAD: “Review of All Aspects of the Set of Multilaterally
Agreed Equitable Principles and Rules for the Control of Restirctive
Busness Practices: Strengthening the Implementation of the Set”,
document TD/RBP/CONF.4/2, May 1995.
8
The World Bank, Trade, Technology and Competitiveness, (IDE
Development Studies).
9
The World Bank, Trade, Technology and Competitiveness.
10
The World Bank, op. cit.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
practices and government policies, do influence firms’
ability to compete.11
In any given market, enterprises have a natural tendency to compete with each other. Under the incentive of
competition, firms will be obliged to perform the best
they can, in order to satisfy consumer needs. They will
constantly try to guess those needs of the consumer
through R&D and innovation. However, the preferred
situation of any supplier in any market is to have a monopoly in order to maximize profits, using RBPs. Accordingly, through competition policy and competition law,
governments; can ensure that these monopolistic tendencies do not translate into actual situations that retard competition in an economy.
Monopoly can exist for a number of reasons. It may
arise as a result of investments requiring large outlays
such those in electricity, water and telecommunications.
These investments often huge investment resources that
cannot be mobilized by require average individuals. Accordingly, in these sectors monopolies have often prevailed, although in recent years the private sector has been
allowed to play a role. In other cases, monopolies have often emerged as a result of the State regulating entry into
such sectors, the reasons often cited are strategic importance and security. However, by so doing, the State has
tended to reduce or eliminate competition in such sectors.
Competitiveness should not simply be viewed as a
country’s ability to export or generate trade surpluses, as
this can be brought about at least temporarily by means of
artificially lowering the exchange rate and/or compressing domestic expenditures. Nor does it arise out of abundant cheap labour or natural resources. In summary, no
simple definition of competitiveness would suffice. It also
does not seem to depend on the level of productivity.
Competitiveness is in fact, a multidimensional concept
that embraces the ability to export, efficient use of factors
of production and natural resources, and increasing productivity that ensures rising living standards of a nation.
6(&7,21,,,
7KHLPSRUWDQFHDQGUROHRIFRPSHWLWLRQSROLF\
D 7KHLPSRUWDQFHRIFRPSHWLWLRQSROLF\
As traditional trade barriers are reduced and globalization progresses, markets tend to become more integrated
and competition stiffer. The conclusion of the Uruguay
Round (UR) trade negotiation reflects a willingness to adjust the multilateral trading system to these new realities
of doing business globally. African countries are now
compelled to face these realities and develop urgent responses to the great challenges posed by current global
developments. The central feature of Africa’s response
must be the strengthening of national policies for
increased international competitiveness and improved
attractiveness to foreign direct investment (FDI).
11
The World Bank, op. cit.
The aim of a law concerning Competition is to promote
economic efficiency and to protect freedom of competition and the competitive process. In a monopoly market
the quantity of a good or service supplied will be less than
that available in a market governed by freedom of competition and the competitive process, and the price charged
may be higher than in a competitive market, or same but
for product of inferior quality. In addition, since the level
of production is lower than that observed where competition prevails, adverse effects on the level of employment
ensue. From this standpoint monopolies are inefficient
and detract from social well-being.12
The international trade system is nowadays concerned
as much with domestic policies and measures of countries
as with border measures. The effective application of
competition policy would put African countries in a better
position to fulfil their trading obligations under various
bilateral and multilateral agreements, such as those of
General Agreement on Tariffs and Trade (GATT) and the
World Trade Organization (WTO). However, a word of
caution is necessary as regards adoption of competition
policy and law by African countries. Wisdom would have
it that African countries should opt for “JUDGXDOLVP” because of the “uncertainty” surrounding the possible impact implementation of “competition policy” at an international level would have on African economies. These
concerns pertain to: the possibility that although trade
competition could certainly lead to industrial restructuring and efficiency, there is also the possibility that it,
could wipe out domestic industry in some African countries; and concerns that advanced countries may not necessarily be following the logic of competition, as has been
the case of the Common Agricultural Policy of the European Union.
The importance of international trade and competition
in the world market has progressively come to be acknowledged. There is hardly a country today that does not
seek to be more closely integrated into the global economy, where the mobility of goods, services and capital has
increased to a point unforeseen only two decades ago.
However, it is also becoming clear that the ability to compete in the world market differs widely-across countries,
industrial as well as developing. Notwithstanding the
various disagreements, the competitiveness debate has
had one important outcome: there is now a much greater
appreciation of the critical role innovation and technological improvements play in the relative economic performance of countries.13
Competition policy encompasses the area commonly
known as anti-trust or anti-monopoly law and practice as
well as various micro-industrial policies affecting markets. Competition laws address essentially two areas: the
conduct of business and the structure of economic markets (The World Bank, 1994). Competition policy prohibits conduct that either unfairly diminishes trade, reduces
competition, or abuses a market-dominating position.
12
UNCTAD, Review of All Aspects of the Set of Multilaterally
Agreed Equitable Principles for the Control of Restrictive Business
Practices, TD/RBP/CONF.4/3, June 1995.
13
The World Bank, Trade, Technology and Competitiveness.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
Competition laws are essentially intended to counter both
conduct policies, structural policies, and performance
policies.
As for conduct policies, Competition law is intended to
counter a number of elements, including:
ii(i) Horizontal restraints: That is, unilateral or collective actions weakening or restraining competition
among firms in the same market;
i(ii) Vertical restraints: That is, provisions in contracts
between suppliers and their distributors (and retailers);
(iii) Enforcement standards. The existence of law is
necessary, but not sufficient, to achieve the objectives of competition policy.
As regards, structural policies, competition laws aim to
prevent transactions that would reduce the interdependence of competing suppliers (vertical integration) and increase concentration in market (horizontal integration). It
deals specifically with:
ii(i) Merger control regulation: selectively prohibiting
mergers that would substantially increase concentration in the market or restrain trade among suppliers;
i(ii) Pre-merger notification: allows authorities to review proposed mergers prior to actualization,
thereby making merger control administration
more efficient;
(iii) Enforcement and remedial measures under merger control: designed to preventing the negative
increased concentration effects of the merger.
Performance policies, which include basically administrative pricing by anti-trust authority, whereby the state
compensates for lack of competition by dictating prices or
output.This is usually applied to sectors that display significant natural monopoly characteristics.
Competition policy can also help to ensure that privatization of state-owned enterprises or government procurement are conducted in a pro-competitive manner, that
granting of exclusive rights or subsidies are subjected to
competition criteria, that intellectual property rights are
not abused, and that the effects of trade liberalization are
not reduced by foreclosure of distribution channels. The
basic objective of competition policy in Africa should be
to inculcate enterprises and the general public with a
dynamic “competition culture.”
E 7KHUROHRIFRPSHWLWLRQSROLF\LQ
HFRQRPLFUHIRUPV
Although there is broad consensus on the general direction institutional and policy reforms should take. The
poor economic recovery in many Africa countries has to
a large extent been attributed to “poor macroeconomic environment”, including the environment in which firms operate. Accordingly, calls have been made for African
countries to intensify macroeconomic reforms in order to
stimulate economic growth and promote international
competitiveness (Williamson 1990).14
In most of the East Asian economies that are part of the
“East Asian Miracle” (Hong Kong, Indonesia, Japan, the
Republic of Korea, Malaysia, Singapore, Taiwan-China,
and Thailand) government undertook a package of measures designed to promote economic growth. The East
Asian countries success was based on a combination of
factors, particularly the high saving rate, interacting with
high levels of human capital accumulation, in a stable,
market-oriented environment—but one with active government intervention—that was conducive to the transfer
of technology (Joseph E. Stiglitz, 1996). The combinations of these policies, led those countries to accomplish
three functions of growth: accumulation, efficient allocation, and rapid technological catch-up (Joseph E. Stiglitz,
1996).
The general aim from various country competition legislation is to control or eliminate restrictive agreements or
arrangements among enterprises, or acquisition and/or
abuse of dominant positions of market power, which limit
access to markets or otherwise unduly restrain competition, adversely affecting domestic or international trade or
economic development.
In most countries restrictive trade practices, on the one
hand, generally refers to cooperation agreements between
enterprises, monopolies and concentrations, mergers and
takeovers, collusive tendering, and abuses of dominant,
which are the practices set out in section C and D of the
United Nations Restrictive Business Practices Set. Agreements fixing prices is among the most common forms of
restrictive business practices, and irrespective of whether
it involves goods or services, imports 1 or exports, is considered as RXWULJKW SURKLELWLRQ in many countries.15 On
the other hand, certain cooperation agreements between
enterprises can be authorized under particular circumstances. This apply particularly where such arrangement
are designed to promote overall economic efficiency and/
or the competitiveness of such enterprises vis-à-vis large
enterprises, or to promote consumer welfare. In any event,
it would be up to the Competition Authority to decide on
the basis of an evaluation of agreements or arrangements.
This is the case in Algeria (Article 9), Gabon (Article 10),
Morocco (Article 7) and Kenya (Part II.5).
Competition issues are closely inter-related to the protection of consumer interests. Restrictive business practices affect the consumer either by way of higher prices or
limitations on availability or choice of goods or services.
In Africa most countries recognise the close interrelationship between competition policy and consumer protection
and in some cases include sections covering unfair trade
practices within their competition policy legislation.16
This is in line with the United Nations General Assembly
resolution on Consumer Protection in which comprehen-
14
The World Bank, The East Asian miracle, 1993.
This is the case of Algeria, Kenya, Gabon, Côte d’Ivoire,
Morocco, South Africa and Tunisia.
16
See for example Competition Policies of Côte d’Ivoire, Gabon
and the Competition Framework in Malawi.
15
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
sive guidelines on this issue were adopted and distributed
to appropriate bodies of individual States.17
In Gabon, for instance, competition law lays down
measures devoted to the promotion and protection of consumed economic interest, along with standards for the
safety and quality of consumer goods and services, distribution facilities for essential consumer goods and services.18
Entry of foreign firms as a consequence of the overall
economic reform policy can inject competition into a host
country market, particularly if the market has a limited
number of domestic suppliers relative to its size prior to
the foreign firm’s entry. In such a situation, the process of
competition could involve lower prices (especially if the
foreign firm is more cost-efficient than local firms) or, as
is more likely, product differentiation and advertising.19
This could in turn involve the introduction of new products based on innovatory activity by the foreign firm involved. Entry of foreign firms can then be expected to improve the performance of the concerned industry and
increase consumer welfare by lowering prices, improving
product quality, increasing variety and introducing new
products, and ultimately provide the development of the
country, provided that the overall local market continue to
function efficiently.
Foreign investment and ownership regimes are also
important complement to trade policy and an element of
the import competition framework. Import competition
(free trade) provides for market access while foreign investment and ownership provides for market presence
(foreign-owned domestic production). Indeed both increase competition. Direct market participation from foreign entities can be a powerful competition devise. Thus,
it adds heterogeneity, brings newer technologies and vision, and it limits domestic advantages based on transportation and border related transactions costs and non-tradable factors. In addition, direct foreign investment allows
the home country to retain most of the benefits of trade
liberalization. Clear legislation, opening domestic market
to foreign participation, recovery of foreign investment,
and the absence of ownership restrictions, are all essential
for an effective competition policy.20 The objective is to
facilitate the development of technological infrastructure
and access to, and transfer of, foreign technology and to
foster innovation.
In a broad sense, all the provisions of the Uruguay
Round Agreements have a bearing upon competition
since the encouragement of international competition is
the basic rationale of trade liberalization. Since its birth in
1947 the General Agreement on Tariffs and Trade
(GATT) has sought to liberalise world trade and provide
a secure world trading system by preventing countries
adopting protectionist policies as was the case during the
17
General Assembly resolution 39/248 of 9 April 1985 on Consumer Protection.
18
Règlement de la Concurrence au Gabon, Loi no. 5/89 du 6 juillet,
1989, Titre III, Articles 12-15.
19
UNCTAD, World Investment Report 1997.
20
The World Bank, The Interface of Trade, Investment and Competition Policies, Policy Research Working Paper no. 1393, December
1994.
inter-war period. This were achieved over the years
through a series of rounds of complex negotiations aimed
at strengthening the rules of international trade, lowering
trade barriers, and expanding the sectoral coverage of the
GATT's rules. The success of the GATT in lowering trade
barriers and hence, increasing world trade can be seen
from the fact that on the one hand, world trade (both export and imports) grew at an annual average rate of 6.5 per
cent in the 1950s, 9.2 per cent in the 1960s, and reached
phenomenal growth (expanding by over 20 per cent)
during the 1970s.21 The basic causes were a general economic upsurge as a result of the lowering of tariffs by the
developed countries either unilaterally or through multilateral trade negotiations (MTNs) carried out under the
auspices of the GATT.
On the other hand, the growth of trade decelerated significantly during the 1980s (6.0 per cent per annum) due
to the so-called “new protectionism” in the developed
countries. This was due to the slow down in economic
growth and raise in unemployment since the mid-1970s.
This gave rise to new forms of discriminatory trade practices, which often fell outside of the regular boundaries of
the GATT. Important examples of this discriminatory
trade practices are the non-tariff barriers (NTBs), which
are not transparent in nature, the Multifibre Arrangement
(MFA) which exclude textile and clothing from the gamut
of the GATT, the evasion of the most-favoured-nation
(MFN) treatment by formation of regional trading blocs
and the unilateral granting of preferences by the OECD
countries to the developing countries. These practices
undermined GATT's basic objectives. Even worse, the
system of “tariffs escalation” adopted by the developed
countries according to the degree and the stage of processing (referred to as phenomenon of “cascading”) has been
harmful for the developing countries trying to diversify
their exports.22
6(&7,21,9
7KH HYROXWLRQ RI FRPSHWLWLRQ SROLF\ VRPH DIULFDQ
FRXQWU\ H[SHULHQFHV
African countries have made significant strides to liberalize their trade regimes, although much still needs to be
done in order for their economies to be effectively integrated into the global economy. The dilemma that continues to face these countries is to respond to the inherent
inequities of the world trading system which basically
arise from an asymmetrical distribution of economic
power between the developed and developing countries.
D 7KH/HJLVODWLYHDQG5HJXODWRU\)UDPHZRUN
IRU&RPSHWLWLRQ3ROLF\DQG/DZ
There is no common rule for the elements of competition law that a country should adopt. The different com-
21
The World Bank, the Interface of Trade, Investment and Competition Policies, Policy Research Working Paper No. 1393, December
1994.
22
The World Bank, op. cit.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
petition laws enacted by African countries generally reflect the objectives such competition law is intended to
achieve as well as the legal traditions of the countries concerned. Furthermore, such laws come under various titles
such as: “Ordinance on Competition” in Algeria; “The
Restrictive Trade Practices, Monopolies and Price Control Act” in Kenya, “Maintenance and Promotion of Competition Act” in South Africa, “Decree on the Regulation
and Control of Prices and Merchandise Supply and Sells”
in Morocco, “The Competition and Fair Trading Act” in
Zambia, “Law on Consumer Protection” in Tunisia, “Law
on Competition” in Côte d’Ivoire and “Competition
Regulation” in Gabon.
Nonetheless, the “main objectives” of competition
policy and law in African countries appear to be similar,
although stated differently. In Algeria, the objectives of
this law have been stated as: to organize and promote free
and fear markets; to promote economic efficiency, to
maximize consumer welfare; and to encourage transparency in trade practices. In Kenya, they have been stated
as: to encourage competition; prohibiting restrictive trade
practices; controlling/regulating the activities of monopolies; controlling the concentration of economic power;
controlling of prices of some commodities believed to be
essential to the economic development and the welfare of
low income consumers. In SouthAfrica, the objectives of
competition policy and law have been stated as: to provide for the maintenance and promotion of competition in
the economy; to prevent or control restrictive practices,
acquisitions and monopoly situations, and for matters
connected therewith (see Annex).
The “main elements and focus” of competition policy
and law in African countries relate to: restrictive business
practices; monopolies and concentration of economic
power; mergers and takeovers; enforcement machinery;
and extra-territorial coverage. As regards “restrictive
business practices”competition policy and law has tended to focus on issues of limitation of access to markets;
limitations to free pricing; market allocation; collusive
tendering; customer discrimination; discriminatory discounting; vertical price collusion; horizontal collusion on
conditions of supply; and horizontal collusion on market
sharing. (see Annex). In respect of “monopolies and concentration of economic power” the competition laws enacted in African countries have focused on: unjustified
actions to sell; customer discrimination; tied purchasing
conditions; resale price maintenance; abusing dominant
market position; and unwarranted concentration of economic power.
On the issue of “mergers and takeovers”, in Côte
d’Ivoire mergers and takeovers require prior consultation
with the Competition Authority and in Kenya and South
Africa. such mergers/takeovers are regulated/controlled
on a case-by-case basis. In Zambia, mergers between two
or more independent enterprises engaged in manufacturing or distribution require approval. As regards “enforcement mechanisms” for non-compliance with competition
policy and law, a number of African countries introduced
into this legislation ways of exacting penalties for defaulters. Type of punitive measures include: fine, in proportion
to gravity and clear-cut illegality of offence or in relation
to the illicit gain achieved by the challenged activity; imprisonment, in cases of major violations involving fla-
grant and intentional breach of the law, or of an enforcement decree, by a natural person; restitution to injured
consumer; and suspension and/or termination, in regard to
certain mergers, acquisitions or restrictive contract.23 As
regards “extra-territorial coverage” of these laws, in a
number of African countries these relate to restrictive
business practices committed in the country concerned.
However, in Côte d'Ivoire, the law has taken into account
the impact of globalization of the world economy as well
as regional arrangements on the behaviour of firms.
Since the mid 1980s, most of the African economies
have been undertaking trade liberalization initiatives in
order to benefit from the rapidly globalizing market. This
wave of liberalization represents an effective shift in development strategy from an inward-oriented, import-substituting, framework designed strategically to reduce dependence on the outer world, to an outward-oriented
export-promoting framework designed to create a virtuous cycle of higher, integration and faster growth with expanded opportunities. Before 1985, trade regimes in
sub-Saharan Africa were characterized by the severity of
quantitative restrictions covering virtually all categories
of commodities and by high tariff rates. Most countries
including Ghana, Nigeria and Tanzania, initiated their liberalization by attempting to reform the foreign exchange
markets to correct highly overvalued currencies, as manifested in high black market premia. These countries accomplished sustained real devaluation of their currencies
by the mid 1980s (see e. g., World Bank, 1996) and both
the rate of improvement in price distortions and the rate of
trade integration were positive. CFA members, however,
failed to devalue their currency during the 1980s or to carry out other trade reforms, only to realize the need for a
substantial devaluation in 1994.
E 6RPH&RXQWU\([SHULHQFHV
As part of the general trend towards the adoption or reform of competition legislation, several African countries
including Algeria, Cameroon, Côte d’Ivoire, Gabon, Kenya, Morocco, Senegal, South Africa, Tunisia, Zambia,
and Zimbabwe have become relatively open trade regimes whereby introducing competition law and establishing competition authority. In other countries such as
Ghana, Egypt and Malawi competition legislation are in
preparation.
In Kenya, the Restrictive Trade Practices, Monopolies
and Price Control Act was introduced in 1988. This law
was introduced to curb unfair market prices, ensure that
consumer welfare is not violated and reducedirect Government controls and regulations in all economic activities within the country.24 The main objective of the Act
is to, encourage competition in Kenyan economy by: prohibiting Restrictive Trade Practices; controlling/regulating the activities of monopolies controlling the concentration of economic power; controlling of prices of some
commodities believed to be essential to economic development and the welfare of low income consumers.
23
See for example Competition Policy of Algeria, Côte d’Ivoire,
Gabon, Kenya, South Africa and Zambia.
24
Kenya, The Restrictive Trade Practices, Monopolies and Price
Control Act, 1988.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
In Malawi, the Government has adopted a Competition
Policy Framework. By this Framework, the Government
is trying to adopt a competition policy and law aimed at
further economic liberalisation, leading to greater competitiveness in domestic markets. The Government also
intends, by this law, to relinquish a number of means by
which it previously influenced private sector operators,
notably business licensing, price controls, and exchange
controls on current account items. The major goals of
competition policy include the protection of consumer interests and the promotion of economic efficiency. The
Government envisages to achieve these goals essentially
through lowering barriers to entry and eliminating restrictive business practices. Three primary areas have been
targeted including business behaviour calculated to eliminate or reduce competition; market structure which permit abuse by an entity in a position of market power; and
government legislation, both existing and proposed,
which may impact on the operation of the free market in
the country. In addition, a Competition Policy Tribunal is
expected to be established to resolve contentious issues in
certain specific fields. The major components of economic liberalisation which are expected to contribute to
increased competitiveness in the economy are:
ii(i) the removal of regulatory controls and business licensing legislation which inhibited entry of new
firms into the market;
i(ii) the liberalisation of the financial sector through
introduction of market-based interest and exchange rates and foreign exchange allocations.
Barriers to entry into the banking system have
been relaxed so as to increase competition in the
provision of financial services;
(iii) the removal of import licensing and the rationalisation of the custom tariff as well as the removal
of domestic price controls;
(iv) the review of investment incentives to encourage
new market entrants; and
i(v) the privatisation of public enterprises with among
other, the objectives of promoting economic effi-
ciency, the encouragement of competition and the
reduction of monopoly power.
In the Republic of Zambia, the Competition and Fair
Trading Act (Act No. 18 of 1994), is the only legislation
in Zambia giving the courts jurisdiction to review a code
of conduct which is “anti-competitive” or “unfair”. The
Act considers anti-competitive trade practices as “any
category of agreements, decisions and practices which
have as their object the prevention, restriction or distortion of competition to an appreciable extent in Zambia”.
Part II of the Act establishes an enforcement machinery:
The Zambian Competition Commission. This Commission is responsible for monitoring; controlling and prohibiting acts or behaviour which are likely to adversely affect competition and fair trading in the country. The
Commission has power to carry out, on its own initiative
or at the request any person investigations in relation to
the conduct proscribed by the Act.
The Commission has an Executive Director who has
powers to seek from a court a warrant granting: authority
to enter any premises; and access to or production of any
books, accounts or other documents relating to the trade
or business of any person and the taking of copies of any
such books account or other documents.25
The Republic of South Africa has a long history on
Competition Legislation going as far back as 1949. While
consumer protection is not a facet of the current (1997)
competition law, however, other Acts (e.g. The Harmful
Business Practices Act, 1988) supply a framework similar
in scope and application to the current Competition Act to
address consumer related business practices. The main
objectives of the current competition legislation are: to
provide for the maintenance and promotion of competition in the economy for the prevention or control of restrictive practices, acquisitions and monopoly situations;
and for matters connected therewith.26
25
Zambia, The Competition and Fair Trading Act, 1994: Part IV,
14 (1)
26
South Africa, Maintenance and Promotion of Competition Act
No. 96 of 1979
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
ECONOMIC LIBERALIZATION IN EGYPT
Prior to the Uruguay Round (UR), Egypt embarked on a comprehensive
shift away from a centralized state toward a market-based, outward-oriented
economy, under the guidance of the High Ministerial Economic Reform Committee. These reforms focused essentially on the following area, macroeconomic
stabilization, trade liberalization, deregulation of price controls and other administrative practices, reorganization of public enterprises and privatization, and the
creation of a Social Fund for Development.
As a main exporter of cotton, rice, citrus fruits, onions and potatoes, a strategy
for agriculture was also worked out together with the government, the FAO, the
UNDP, UNEP and the WFP. The main objectives of the strategy includes to:
• further deepen the liberalization and privatization of the agricultural sector;
• take into consideration the local, regional and international environment;
• conserve, improve and develop resources with optimal utilization;
achieve efficiency, equity combined wit environmental awareness;
• expand exports where there is a comparative advantage and import products
• where there is no comparative advantage;
• improve opportunities for gainful employment in the agricultural sector.
At the time of the finalization of Uruguay Round negotiations, Egypt committed
to bind tariff rates on all items and tariff non-tariff measures on agricultural products according to the terms of the UR, with a compensation mechanism. Egypt
has also undertaken tremendous effort to strengthen and modernize legislation in
the intellectual property rights area. A new law has been drafted to amend the old
paten law of 1954 to conform to the terms of the TRIPs agreement, in particular
to ensure protection for rights holders. Progresses are also been made in improving copyright protection. Importantly, computer programs are now considered as
literary works with a period of protection of 50 years. This conforms to the UR
agreement.
Source: CIDA, Africa and the Uruguay Round, January 1996
6(&7,219
&RQVWUDLQWV RQ FRPSHWLWLRQ SROLF\ LQ $IULFD
Responding to the challenges posed by globalization
and liberalization requires major adjustments in economic
policies, resource allocation and production structure in
African countries. The world economy is increasingly being shaped by the processes of globalization and liberalization. These are interrelated and multifaceted processes
encompassing the growth of international trade in goods
and services and capital flows, the global integration of
production processes, the dominance of market-oriented
economic policies throughout the world, and a significant
degree of institutional harmonization between countries
in respect of trade, investment and other policies mediated
through multilateral and regional institutions. Globalization and liberalization are processes that are unlikely to be
reversed in the foreseeable future and have profound implications for developing countries, including African
countries, in terms of their in the world economy, their
development prospects and the nature of their economic
policies (Onitiri, 1995). With the new trends towards globalization and liberalization, many developing countries
risk being marginalized unless they can adapt and adjust
to the new competitive international environment.
D /RZSDUWLFLSDWLRQLQPXOWLODWHUDO
WUDGLQJ QHJRWLDWLRQV
Africa’s participation at Multilateral Trade Negotiations (MTNs) that have constituted the landmark of international trade relations has been marginalAfrica's participation in the Uruguay Round of negotiations leading
up to the establishment of the World Trade Organization
was peripheral. Many African countries have as yet to
join the World Trade Organization (only thirty-two countries had joined by the beginning of 1997). Furthermore,
even those that have joined very few maintain delegations
at the Headquarters of the GATT/WTO in Geneva to be
able to effectively follow the discussions held on a daily
basis within the framework of the WTO. As a consequence very few sub-Saharan African countries participated in the Uruguay Round of Multilateral Trade Nego-
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
tiations (UR), or paid attention to the formal negotiating
process. The bargaining power of the African countries as
a group was therefore not strong.27
For many African countries, the concepts of competition are not only new, but also very complex. Introduction
mechanisms for enforcement of competition policy, legislation and Competition Authority, has associated costs,
which cannot be born by many African countries particularly at this stage of budgetary austerity and implementation of public sector reforms by many of these countries.
The correct application of such new and complex concepts needs some time. First, a learning process with respect to business and consumer behaviour is essential.
Second, training to change mentalities and to create a
“culture of competition” is also necessary. Moreover, the
legislative process itself is, by definition, an. evolutionary
one, therefore African countries need to go through an
evolutionary process of amending and improving their
legislation in general and their competition laws, in particular.
E /DFNRIUHVRXUFHV
African countries, in parallel with the liberalization of
their trade regimes under structural adjustment programmes, are faced with the difficult and challenging task
of institutionalizing and upgrading their trade legislation
aimed at implementing the WTO Agreements, and developing a regulatory framework that will ensure evolution
of market-based economies. In addition, national laws
and regulations in several African countries may not yet
have been synchronized with basic provisions of the
WTO Agreements.
African countries have been implementing reform programmes with a view to liberalizing their economies and
in order to integrate these economies into the world
economy. Many of these countries hope to benefit from
the strengthening of the multilateral trading system and
expansion of world trade. A number of these countries are
now in the process of trying to bring their trade policies in
line with demands of a globalizing and liberalizing world
economy. Nevertheless, translating trade rights and obligations under multilateral agreements into concrete trade
advantages requires coordinated actions at the country,
sub-regional and regional levels between African governments, the private sector and business community as well
as regional organizations.
It can be observed that in industrialized and some advanced developing countries preparations for international trade negotiations is an interactive process between
government, the private sector intergovernmental and
non-governmental institutions as well as specialized research institutions. This is done in order to arrive at consensus on the issues to be discussed and more importantly
to arrive at a country position.
In many African countries, this culture and process of
consultation in advance of important international negotiations has still to develop and lack of resources also im27
The World Bank, the Impact of the Uruguay Round on Africa,
Discussion Papers no. 311.
poses constraints on developing appropriate institutional
mechanisms needed to advance the process. Many of
these countries find themselves poorly equipped in terms
of human and financial resources to enable them to adequately prepare technical background studies and establish peer working Groups needed to prepare them for
international trade negotiations.28
F 3HUVLVWHQFHRIQDWXUDOPRQRSROLHV
In most economies, there is a set of monopolies that
have emerged as result of economies of scale and the huge
sunk-in costs needed to operate in such industries. In African countries such monopolies, often called “natural
monopolies” are prevalent and concentrated in a number
of important sectors. There is a grouping of “strategic industries” for which arguments are made for the need direct or indirect state intervention. This category often includes water supply, the electricity power, primary health
care, primary education, postal service, etc. Technological change and the advance of the private sector have reduced the irrelevancy of the arguments for government
intervention in what are called “natural monopolies”. The
private sector has been found to operate as efficiently as
the public sector in some of the sectors, and in some cases
even better. However, political patronage that control of
public enterprises gives to governments in power has
proven a major stumbling bloc to privatization of public
enterprises in Africa as well as to the elimination of natural monopolies.
6(&7,219,
&RQFOXGLQJ 5HPDUNV
The globalization and liberalization of the world
economy, in terms of production processes, marketing
and distribution as we’d as technological advances, has
not only opened up opportunities but also brought along
tremendous challenges in terms of ensuring “fair competition” in such liberalized markets. Furthermore, the end
of the cold war and the shift to market-oriented type of
economic structures, not only in the formerly central
planned economies, but also in many others, has also
heightened the debate on the possibility of “state monopolies” giving way to “private monopolies” as many governments reduce their direct intervention in economic activity in the context of “economic reforms.”
The challenges that face the global economy is how to
ensure that globalization and liberalization produces a
“Pareto optimal” situation in terms of increasing global
welfare. In such a situation promoting competition and a
“level playing field” in international production and trade
becomes an imperative. Reducing restrictive business
practices, ensuring that mergers and takeovers do not result in undue concentration of economic power, and
minimizing dumping practices are some of the objectives
and targets of competition policy and law.
28
The World Bank, Trade, Technology and Competitiveness.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
Competition in a market refers to rivalry among sellers
and among buyers of goods or services. It also refers to a
firm’s ability to produce goods and services that meet the
test of international markets and simultaneously increase
its earnings and market share over time. Competition can
be analyzed at national and international levels.
not on factor markets (labour, technology, capital).
Furthermore, issues of competition in the context of privatization of state-owned enterprises which is currently
taking place in the framework of “economic reforms” has
not been given due consideration, and its implications on
economic concentration.
At national level (firm competitiveness), competition
deals mainly with such government actions as: adoption
of competition policy and law and/or its improvement, effective enforcement of appropriate legislation, and the
implementation of judicial and administrative procedures
for the control of Restrictive Business Practices (RBPs).
This involves basically issues of monopolies and concentration of economic power; acquisitions, mergers and
takeover, the enforcement mechanism and extra-territorial coverage.
Given the current stage of development of trade in Africa, the challenges of adopting an appropriate competition policy and law are indeed formidable because of the
dangers inherent in opening up economies which have
hitherto been relatively closed. The need for African
economies to be integrated into the world economy is not
any more an issue. However, the pace at which this should
be done is. Some have called for African countries to
adopt a gradualistic approach in the implementation of
Competition Policy and Law. The choice for each country
will be dictated by the state and structure of development
of the economy, the institutional infrastructure available
as well as the administrative machinery for enforcement
of the legislation enacted to promote competition.
At international level, competition is related to a code
of conduct designed to promote competitiveness in various markets: the set of multilaterally agreed principles for
the control of RBPs. This calls basically for the establishment of consultation procedures whereby a State may request consultation with other States in regard to issues
concerning the control of RBPs. The main issues of competition policy and law at international level and within
the framework of GATT/WTO are related to: safeguards
agreements, subsidies, antidumping, antitrust, trade-related aspects of intellectual property rights (TRIPS), and
trade-related investment measures (TRIMS).
Lessons derived from available African country case
studies suggest that as of 31 December 1996, only 17 per
cent of African countries had adopted Competition Policy
and Law.29 The main stated objectives of these Competition Policies and Laws are basically similar, although they
are stated differently. In most of these legislations, extraterritorial approach is not properly reflected and virtually
all of them do not include such aspects as antidumping,
antitrust, subsidies on production, and non-tariff barriers
to competition and trade. These are indeed some of the issues that are likely to be at the center of the debate on a
possible multilateral agreement on competition policy
and law. Furthermore, all these aspects affect considerably prices of traded and non-traded goods and thereby
the competitiveness of products.
It has been noted that many of the competition policy
and laws enacted by African countries tend to emphasize
competition on product markets (goods and services) and
29
Algeria, Cameroon, Côte d’Ivoire, Gabon, Kenya, Morocco,
Senegal, South Africa, Runisia and Zambia.
In the context of developing a multilateral agreement
on competition policy and law, the extent to which the final agreement will reflect African countries views on the
issue will to a large extent depend on their active participation in the WTO activities. This is essential if Africa is
to benefit from the strengthening of the WTO. This requires constant involvement by these countries in the
work of WTO councils, committees, and working groups,
as well as in the day-to-day negotiations that take place on
some of these issues. This, in turn, requires more resources being allocated by African countries to follow-up
on WTO issues, professional back-up and improved coordination between different governmental agencies.
This study has tried to provide African countries with
some understanding of the issues of Competition Policy
and Law within the framework of the international debate
currently taking place. More importantly, the study has
been undertaken to assist those countries that are in the
process of adopting competition policy and law with
some insights and lessons that can be derived from other
African countries. Furthermore, as the debate on the issue
of how to promote competition in the world economy
within the framework of the increased momentum towards globalization and liberalization intensifies, African
countries need to be abreast of the issues that are likely to
occupy center stage in this debate. Indeed these issues
will include: safeguards agreements, subsidies, antidumping, antitrust, trade-related aspects of intellectual property
fights (TRIPS), and trade-related investment measures
(TRIMS).
ANNEX
Main features of African competition Policy and Law
Algeria
Côte d’Ivoire
1. Main objectives of competition law and policy
Gabon
Kenya
South Africa
Zambia
—To encourage competition
in the economy by prohibiting anticompetitive
trade practices:
—To regulate monopolies
and concentrations of
economic power;
—To protect consumer welfare;
—To strengthen the efficiency of production and
distribution of goods and
services;
—To secure the best possible conditions for the
freedom of trade;
—To expand the base of
enterpreneurship;
—To provide for matters
connected with or incidental to the foregoing.
—Price cooperation or collusion;
—Resale price maintenance;
—Refusal to sell/deal;
—Discriminatory discountring;
—Customer discrimination;
—Market allocation
—Trade agreement fixing
prices;
—Collusive tendering;
—Market customer allocation;
—Collective actions to
enforce agreements;
—Concerted refusal to supply goods and services to
potential purchasers.
2. Main elements of the
competition
2.1 Restrictive
Practices
Business —Limitation of access to
markets;
—Limition and/or control of
producers, suppliers or
investors;
—Market allocation;
—Limitations on free pricing
—Coordinated
activities
among economic entities
which restrict or impede
competition;
—Collusive tendering;
—Refusal or discrimination
in supply;
—Limiting or restricting the
terms and conditions of
sale or supply of goods
and services
2.2 Monopolies and con- —Unjustified action to sell; —Abusing dominant posicerntration of economic —Customer discrimination
tion;
power
—Tied-purchasing condi- —Concentration of economic power;
tion;
—Resale price maintenance. —Limitations of access to
market or restrictions on
free competition.
—Limitation of access to
market of restrictions on
fee competition;
—Market or customer allocation agreement;
—Limitations of free pricing;
—Limitations or controls
of suppliers or investors
—Resale price maintenance;
—Vertical price collusion;
—Horizontal price collusion;
—Horizontal collusion on
conditions of supply;
—Horizontal collusion on
market sharing
No clear definition, but the —Unwarranted concentra- No specified
tion of economic power
law refers to “Any agreement, arrangement, explicit
or implicit understanding or
method of trading which:
—limits access to the market or restricts competition;
No specified.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
—To organize and promote —To improve enterprise’s —To provide for the maintenance and promotion of
institutional environment;
free and fear competition
competition in the econexercise;
—To encourage and proomy;
mote free trade and trans—To maximize consumer
—To prevent or control
parency;
welfare;
restrictive
practices,
—To encourage transpar- —To create conditions for
acquisitions and monopthe
development
of
ency in trade practices.
oly situations, and for
national enterprises.
matters connected therewith.
Main Features of African Competition Policy and Law (continued)
Algeria
Côte d’Ivoire
Gabon
Kenya
South Africa
Zambia
—Encourages market sharing or supply distribution;
—Limits free pricing;
—Limits of controls suppliers of investors”.
2.3 Merges and takeovers
—No specified
—Prior consultation with —No specified
the competition authority
is required
3. Enforcement machinery
for competition policy
and law
3.1 Enforcement authority
Conseil de la Concurrence —Commission de la Con- —Commission de la Con- —Monopolies and Prices —Competition Board (Art. —Zambia
Competition
(Art. 16)
currence (Art. 6)
currence (Art. 2)
Commission (Part I, 3 (1))
3 (1))
Commission (Art. 4)
3.2 Penalties for non-com- —Violation of the law: (1) —Violation of the act and Violation of RBPs: (1) abus- Violation of RBPs: losses of —Violation of RBPs: acqui- —Violation of the Act, any
regulation made hereunsitions, and monopoly sitincome or any damage: a
ing economic power,
other regulations for its
plicance
price collusion: a fine
der or any directive: a fine
uations: suspension and/
fine of two times the
coordinated
activities
implementation: a fine
from DA 5.000 to DA
up to ten million kuacha
or termination of the
value of the losses or
which restrict or impede
between CFA 200.000 to
500.000; (2) refusal to
or imprisonment for term
membership of a member
damage: restitution to
competition, collusion,
CFA 5.000.000.
issue invoices: a fine from
up to five years of to both.
in regard to certain merginjured consumer;
refusal
to
sell/deal;
DA 5.000m to DA
ers acquisition of restricimprisonment from 3 —Merger/Takeover: impris1.000.000; or imprisontive contract.
months to 3 years and/or a
ment from 1 month to 1
onment for a term up to
fine from CFA 50.000 to
year, or any of the two.
five years or a fine up two
CFA 90.000.000 and a
hundred thousand shil—Refusal to comply with
penalty of CFA 5.000 per
lingts or to both
decisions or orders of the
each day after the timecompetition authority; a
limits; (2) price collusion:
fine from DA 5.000 to
imprisonment form 1 to 6
DA 100.000; imprisonmonths and/or a fine from
ment form 2 months to 2
CFA to 30.000 to CFA
years, or any of the two.
30.000.000.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
—Regulated/controlled on a —Handled on case-by-case —Merger between two or
case-by-case basis
basis
more independent enterprises engaged manufacturing or distributing substantially similar goods or
providing substantially
similar services;
—Take over of one or more
such
enterprises
by
another enterprise, or by
a person who controls
another such enterprise.
Algeria
Côte d’Ivoire
Gabon
Kenya
Main Features of African Competition Policy and law (concluded)
South Africa
Zambia
4. Extra-territorial coverage —No indicated
Source : ECA compilation.
—Competition policy and —No indicated
law takes into account the
concept of globalization
of the world economy and
the country’s membership
of the UEMOA.
—Restrictive trade practices —No indicated
committed within the
country
—The anticompetitive trade
practices provisions apply
to all practices, acts or
behaviour whether or not
those are embodies in an
agreement so long as their
object i s to discourage
competition in Zambia.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
—Failure to supply information
or
documents
required by the competition authority: imprisonment from 3 months to 3
years and/or a fine from
CFA 50.000 to CFA
90.000 and a penalty of
CFA 5.000 per each day
after the time-limits
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
5()(5(1&(6
$OJHULD, Ordinance No. 95-06 du 25 janvier 1995 relative à la concurrence;
&{WHG¶,YRLUH, Loi No. 91-999 du 27 décembre 1991 relative à la concurrence;
*DERQ, Règlement de la concurrence au Gabon (Loi No. 5/89 du 6 juillet 1989);
.HQ\D, The Restrictive Trade Practices, Monopolies and Price Control Act, 1988;
0DODZL, Ministry of Commerce and Industry, Competition Policy Framework for
Malawi, November 1996;
0LFKDHO(3RUWHU, the Competitive Advantage of Nations, Macmillan Inc. 1990;
0RURFFR, Décret No. 2-71-580 du 23 décembre 1971 sur la réglementation et le contrôle
des prix et les conditions de détention et de vente des produits et marchandises;
2&'(, L’accès au Marché après le Cycle d’Uruguay, 1996
3DXO.UXJPDQ, POP Internationalism, the MIT Press, 1994;
3HWHU)'UXFNHU, Innovation and Entrepreneurship, Practice and Principles, Harper &
Row Publishers, 1984
6RXWK$IULFD, Maintenance and Promotion of Competition Act, 1979;
7KH:RUOG%DQN, Competition, Competition Policy and the GATT, December 1993;
7KH:RUOG%DQN, International Competitiveness: Interaction of the Public and the Private Sectors, May 1991;
7KH :RUOG %DQN, the Impact of the Uruguay Round on Africa, Discussion Papers
No. 311.
7XQLVLD, Loi No. 91-64 du 29 juillet relative à la concurrence et aux prix,
81(6&$3, Asian and Pacific Developing Economies and the First WTO Ministerial
Conference ISSN 1020-3516;
81&7$', Continued Work on the Elaboration of a Model Law on Laws on Restrictive
Business Practices, TD/B/RBP/81/Rev.4;
81&7$', Intergovernmental Group of Experts on Restrictive Business Practices: Competition Policy and Restrictive Business Practices, 29 January 1996;
81&7$', Intergovernmental Group of Experts on Restrictive Business Practices: Competition Policy and Legislation, 8 March 1996;
81&7$', Participation of Developing Countries in World Trade: Overview of Major
Trends and Underlying Factors, WT/COMTD/W/15;
81&7$', Preparations for a Handbook on Restrictive Business Practices Legislation,
TD/B/RBP/58, Add.1;
81&7$', Strengthening the Participation of Developing Countries in World Trade and
the Multilateral Trading System, Geneva, 1996;
81&7$', The Role of Competition Policy in Economic Reforms in Developing and
other countries, Geneva 13 November 1995;
81&7$', World Investment Report 1997, Sales No. E. 97. II.D.10;
:72 Ministerial Conference: Issues of Concern, ST/ESCAP/1705.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
,QWHJUDWLQJFRPSHWLWLRQSROLF\LQWKH&20(6$UHJLRQDO
HFRQRPLFFRRSHUDWLRQDQGLQWHJUDWLRQSURFHVV
%\+RQ'60SDPED
Minister of Commerce, Trade and Industry of Zambia
7KH JURZLQJ HPSKDVLV RQ FRPSHWLWLRQ ODZ DQG UD
WLRQDOH
lution has occurred with the member states of COMESA
unanimously agreeing to the “zero tariff” regime by the
year 2000. These initiatives give the COMESA countries
the framework and direction for the 21st century.
The implementation of competition policy has continued to be not an easy matter in the majority of developing countries. Until about a decade ago, well developed
competition law systems were largely limited to developed countries. In recent years, however, a large and increasing number of developing countries and economies
in transition have adopted new or substantially improved
competition legislation as part of a drive to establish
healthy market economies.
The “zero tariff” regime sets out the completion of the
common market by the year 2000. This will launch an ambitious programme for the abolition of the remaining barriers to the free movement of goods, services and capital
in the COMESA region. The process of adaptation to this
is now already well under way and is essential to the
convergence of the various economies of COMESA
countries.
In general, the increasing importance of competition
policy in developing countries and economies in transition reflects a growing appreciation of the relationship between the objectives of competition policy and those of
market-oriented reforms, including both internal reforms
and trade liberalisation. In particular, reforms adopted in
the COMESA member states in recent years have the
broad objective of improving the functioning of product,
capital and factor markets domestically, while also facilitating adaptation to international competition. Competition policy is a tool that reinforces the beneficial effects of
such are passed on to consumers, while also facilitating
successful adaptation to international competition.
A zero tariff structure for COMESA countries means
that goods and services will freely be moved between borders without customs duties being levied on them unless
otherwise justified as provided for under the treaty’s safeguards in case of felt injury on the importing country.
Further the zero-tariff position to be obtained in the
year 2000 will affect the regional governments directly in
terms of loss of customs duty revenues. The business
community in the respective countries will have to withstand intense and sometimes devastating competition on
their market offerings vis-à-vis suppliers from other
COMESA countries. These two likely consequences are
seemingly bitter pills to swallow by individual member
states. This is because you do not go into something that
in turn hurts you. While these fears may be genuine, it has
been empirically established that the government revenue
losses are not significant (ranging from 0.1% to 11% of
national budgets) and that in most cases they can be offset
by revenue collections from the broadened domestic tax
base due to the rising levels of tradable goods and services
on the domestic markets.
It is gratifying that today we witness the beginning of
the long awaited process of employing competition policy
as an instrument of regional economic integration. There
have been requests from member states, especially those
with established competition authorities, calling for cooperation in the implementation of competition policy in
COMESA member states. Some have gone to the extent
of calling for the establishment of a harmonized competition regime in the southern and eastern African regions
under the auspices of COMESA. I am informed that this
Seminar will among other topics explore this matter in
much detail.
In this situation both the local and COMESA suppliers
will be subjected to the same domestic sales and excise
duties. As regards the concerns of local suppliers, it is
here assumed that anti-dumping policies in the exporting
member states will be in force and the aggrieved importing countries would have recourse to article 51 of the
Treaty which also provides for the levying of anti-dumping duties.
7RZDUGVWKH]HURWDULIIVWUXFWXUH²\HDU
As you are aware, the COMESA region is moving towards the zero tariff structure in the year 2000. As the
common market approaches, businesses throughout the
COMESA region have to gear themselves up to face new
challenges and grasp new opportunities. A transformation
is already taking place as companies adapt to new conditions and to the emerging reality of a common market of
over 300 million consumers. Further impetus to this evo-
On the whole, intense competition amongst suppliers
in the region is what we need to enhance efficiency and
consumer welfare. Given the enlarged market, the suppliers will be able to achieve economies of scale. This will
enable them compete efficiently in the common market.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
1HHG IRU FRRSHUDWLRQ LQ LPSOHPHQWLQJ FRPSHWLWLRQ
SROLF\LQ&20(6$PHPEHU6WDWHV
will make it possible to dismantle trade instruments such
as anti-dumping and countervailing duties within the
region.
Allow me to comment briefly on those factors which
lead us in eastern and southern Africa, especially those of
us who are members of COMESA, to the belief that increased regional cooperation is essential—even inevitable—in the coming years. Without pre-empting your
deliberations in the next two days, I would like to mention
that two main factors have nurtured the belief that increased regional cooperation is essential in the new trade
order. The first is increased globalisation. The second—
stemming directly from this increased globalisation—is
the inevitability of increasing overlap, and thus contact,
between the activities of national competition authorities.
Secondly, even if competition law were enforced with
equal determination by all the world's main trading partners, closer cooperation among competition authorities
would still be necessary because more and more competition problems transcend national boundaries. International cartels, mergers or abuses of market power are rarely
limited to just one country. It is not surprising, that national authorities face increasing difficulties in dealing with
such cross-border practices. Crucial evidence may be located outside their jurisdiction. Other agencies looking at
the same case, might adopt a different approach or different remedies. Consultation and some exchange of information and/or coordination of enforcement action may be
the only way to apply the competition rules effectively.
Globalisaiton is no longer a trend, but a reality which
is changing our lives. We are all familiar with the work of
COMESA and the resulting reduction in tariffs which has
led to a boom in regional trade—from about US$ 1.6 billion in the early 1993 to over US$ 4.2 billion in 1998. An
increasing part of this is represented by “vertical trade”
in which stages in the production chain are completed
by companies and sometimes by the same company, in
different countries.
With the increasing influence of new technologies this
process will continue to accelerate in the coming years.
In particular the “telecommunication revolution”,
which has only just got under way, is certain to have a dramatic impact. Another consequence of globalisation is
that regulatory measures adopted in one country may
have a positive or negative impact in other countries. This
is clearly true of the environment, but the same can be
said about fiscal and monetary policies, securities regulations, standards, certification procedures and many other
fields of government activity. Similarly the way competition policies are enforced has an inevitable impact on a
country's trading partners. In this regard, we can identify
two different problems. First, in a region where state imposed trade barriers are disappearing, especially in the
wake of complying with the zero—tariff structure, anticompetitive practices are becoming more prominent in
determining the development of cross border trade. There
is a risk that public trade barriers may be replaced by restrictive business practices, undermining years of effort to
liberalise trade. We continue to witness the phenomenon
within the common market. Even after agreeing to the
zero tariff market structure, we are still seeing businesses
trying to convince their respective governments to the
take steps to protect their traditional “national markets”.
It is because of this emerging factors that even after the
attainment of zero tariff in the region, countries still need
to develop new ways of safeguarding their domestic markets against the likely effects of anti-competitive practices among firms such as anti-dumping and countervailing duties.
Thus it becomes imperative to have an effective competition policy in the region that will fill this vacuum.
Along with other provisions for the elimination of restrictions to trade, the implementation of an effective and
uniform competition policy in COMESA member states
,PSHGLPHQWVWRFORVHUFRRSHUDWLRQ
However, I have to warn the participants that there are
some deep rooted impediments to closer cooperation, and
I wish to call upon this Seminar to discuss these impediments thoroughly and come-up with workable solutions.
Given the face of globalisation, the increasing interconnection and inter-dependence of national economies,
and the increasingly international nature of commerce
which has resulted from these trends, the need for cooperation in the implementation of competition policy
among COMESA countries has become paramount.
However, you should be wary to the fact that competition
policy is influenced by political change and a developing
understanding of economics. Above all, policy must
adapt to the rapid evolution of the industries and markets
that are its focus of attention.
Another obstacle to cooperation among competition
authority, Mr. Chairman, stems from the very nature of
competition policy. This will be better understood when
during your deliberations you compare competition policy with trade policy.
([LVWLQJPRGHOVRIFRRSHUDWLRQ
I think it would be unfair if I closed my speech without
making a brief reference to the existing models of cooperation. I know you will be able at the end of this Seminar to make far reaching recommendations in relation to
this matter. What I would like to suggest is for the participants to take advantage of the presence of the various
experts and find out more about experiences of the several
bilateral agreements that have been concluded in this direction.
I am informed that two international organisations,
UNCTAD and OECD, have already made efforts to develop principles of cooperation. The UNCTAD “set of
rules” which is one of the topics you will be discussing
provides an interesting model for possible future common
basic rules on competition. This is important, especially
for those countries which have not established a competition authority as yet. Turning to Europe, it may be fairly
stated that the world's most sophisticated mechanism for
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
regional cooperation in competition law and policy is that
developed by the European union. I hope the participants
of this Seminar will draw a lot of experiences from these
models.
The important starting point, should be the need for all
countries in the region to have adequate domestic competition laws coupled with adequate enforcement instruments.
In light of what I have said, COMESA’s efforts and
achievements on the subject of regional competition law
and policy can be put in context and be encouraged. At
this juncture, I wish to acknowledge the position that the
COMESA trade and customs committee, which met in
April this year, took in terms of Article 55 of the Treaty
which calls for fair business practices and competition
among member states. The committee recommended for
the establishment of a COMESA competition policy and
a study is to be undertaken to that effect with the cooperation of member states. It is gratifying to note that in
fact the terms of reference for the study have already been
drawn and approved by the Committee. This is a step in
the right direction and the study should be expedited.
I wish to finally urge all the distinguished delegates to
take active participation during the deliberations of the
Seminar. As at the end of this Seminar, you will be expected to play a vital role in advising your respective governments on matters pertaining to the implementation of
competition law and policy.
I note that international experts have been brought in to
assist us think and discuss through various issues towards
a regional competition policy. I wish to thank them sincerely for responding positively and at short notice. We
need you in executing this mammoth task.
The organisers of this Seminar have informed me that
this workshop has been made possible through the financial assistance provided by UNCTAD and UNDP. I
would like on behalf of all the countries represented here
to sincerely thank the two institutions for the good gesture. I urge all of you to please find time to visit some interesting sights of our beautiful city of Lusaka and to visit
our country-side. I hope you will enjoy and like what you
see.
It is now my sincere honour and pleasure to declare this
regional competition law and policy Seminar officially
open. I wish you successful deliberations.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
(FRQRPLFDQGPDUNHWVWUXFWXUHVLQ&20(6$
DEXVLQHVVSHUVSHFWLYH
%\0HEHOR.10XWXNZD
Zambia Association of
Chambers of Commerce and Industry
,QWURGXFWLRQ
imperative that COMESA Member States harmonise conditions and their national marketing strategies, as discussed later, to make the common market attractive to
those still situating their projects in Botswana or South
Africa, or to take further steps at integration of all SADC
economies into one body.
It is humbling to be in such esteemed company and I
shall attempt to avoid being intimidated by the collection
of degrees and certificates flooding this venue. I submit
the observations of a business community that can sometimes be accused of being inadequately engaged in the unfolding evolution of COMESA, a consequence of the
heavy political tilt of the original framers of the Treaties,
and the continuing sequence of decision—making and
operations that commences with Heads of State acting as
the apex decision-making body in the form of the Authority, supported by the Council of Ministers, which oversees the Inter-Governmental Commission, all serviced by
the Secretariat.
&RQVWUDLQWV
Intra-COMESA trade has increased and the tariff variable is now forming an important component of decisions
on where to import from, and even where to situate a
warehousing or manufacturing facility to exploit the competitive advantage.
The countries in the region have erected, or more accurately, not dismantled their uneven and sometimes inconsistent Tax Regimes and Investment Codes, divergent
Regulatory Environments (such as having Competition
Commissions and Privatisation Agencies), phytosanitary
and licensing differences between states, and a treasure
trove of non tariff barriers to trade. The situation is improving but remains a retardant to the growth of
COMESA conglomerates straddling the region.
This is reasonably consistent with other regional economic groupings but does not make formal provision for
the input and participation of the business community.
We seek a more consistent, permanent, and formalised
role in COMESA’s march towards creating a united economic bloc.
'HYHORSPHQWV
Domination from the South remains the equivalent of
the lunatic uncle in the spare bedroom, with everyone, including the neighbours, aware of his existence, but not
fully acknowledging his presence. The SADC question
needs to be urgently addressed, though some could argue
that RSA is an economic bloc on its own, begging the
question that the relaxation of tariffs with RSA may require an independent time-table, that allow s COMESA
products into RSA on preferential terms (not negotiated
by individual countries) with the tariffs on South African
goods being reduced at a slower rate, to allow for eventual
free trade after 7-10 years.
The onset of globalisation and the consolidation of
Economic Groupings in Asia, North and South America,
Europe, and West Africa, necessitates a concomitant response in Eastern, Central and Southern Africa to avoid
being swamped by better organized groupings and more
importantly, to create a wider common market to attract
pooled investment and to strengthen the groups negotiating position.
The concerted, though uneven, reduction of tariffs in
the expanding COMESA region has confounded the naysayers and we have become converts/worshippers to the
altar of free regional trade.
The business community has, generally, been anxious
about the implications of enhanced competition in the region, with particular concern relating to the business entities in more developed economies within COMESA.
The old adage, 'Familiarity breeds contempt' is applicable in much of our region. We, brothers and sisters, tend
to assume that the quality of intra-COMESA goods, services and investment are inferior to those of the West or
the South.
Competition has been exacerbated during the past five
years, though the greatestimpact has been the competition faced by a non-COMESA member, the Republic of
South Africa. The other anticipated benefit of the economic integration of the region, i.e. increased foreign direct investment inflows designed to take advantage of the
expanded common market, has yet to materialise, and it is
The fragmented assistance and advice received by private business in COMESA is interesting to consider.
From Bulawayo to Cairo, we have been advised to grow
roses for export. The hectarage under greenhouses has expanded accordingly, seeking sales on the same auction
floors in Holland, and constraining prices by introducing
excessive competition.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
5HFRPPHQGDWLRQV
Individual chauvinism must be expunged to improve
the region’s ability to attract investment and to enhance
intra-COMESA trade. This involves the enhancement of
an opportunities database that scans and disseminates information on the comparative advantages of COMESA
countries, their resources, the broader market with its attendant demand, and a legal framework and implementing institutions straddling the region.
The COMESA Secretariat, in conjunction with the Investment Promotion Agencies of COMESA member
states, should coordinate “Invest in COMESA” Conferences highlighting opportunities in the region, for trade
and investment, in Europe, Asia, the Americas, Australia,
and South Africa to attract investment that can realise
Economies of Scale, and create employment in the region.
Over time, there will be no option but to harmonise
Tax Regimes, particularly in relation to Value Added
Tax, Withholding Taxes on Dividends (consider developing Tax Treaties that exempt companies from tax on dividends if the dividend is remitted to another COMESA
country) and Corporate Tax. The current maze of taxes
and licensing laws are an unbearable expense for business.
COMESA is potentially a powerful, prosperous Economic Bloc that should be negotiating outward with other
regional groupings and neighbouring countries (read
South Africa), and to reinforce positions relating to World
Trade Treaties.
A major hindrance to the growth of business relations
amongst COMESA companies is the diversity of Currencies, most of which Exporters would prefer not to touch,
and which are crowded out by United States Dollars. The
ill-fated UAPTA was a noble effort to address the currency problem, though it appears that the 'familiarity' argument, and the lack of faith in the underlying strength 1 asset reinforcing the UAPTA. Regional trade remains
dollar-based, and credit provision, both short and long
term, remains dollar indexed and companies are compelled to demonstrate that they will always have access to
foreign currency reserves, and it is simply considered not
good enough to earn Zim$ or KShillings, regardless of the
volume or margins. No mention shall be made of the
Kwacha. We suggest that Foreign Currency Guarantees
be provided to underwrite COMESA currency transactions. This is, apparently, in progress.
Cross-Border Listings are a dream of many COMESA
business houses, which aspire to access Capital Markets,
institutional savings, and venture capital in the region,
with a view to creating regional companies and acknowledging the narrow scope and funding of individual Stock
Markets in the region.
The consideration of a Regional Airline requires further attention, as we continue to be compelled to travel out
of the region to visit another part of the region because of
the absence of direct flights. Equally, there is a tendency
to use foreign carriers to transport produce from
COMESA to other regions, and there are opportunities for
improved pooling of produce to obtain minimal cargo
rates.
The Governments of the region are assessing the financial impact of a Free Trade Area on their individual budgets and it will be imperative that clarity is provided regarding the division/ allocation of Border Tariffs
collected at the relevant Ports of Entry. An allocation that
favours the least developed COMESA members would
serve to reduce the anxiety of the weaker COMESA members and those in landlocked positions, who could be the
main losers in a free trade area.
The COMESA Court of Justice offers a critical positive step in handling legal issues under COMESA, but it
remains imperative that a fast track Arbitration system,
acceptable and legitimate to all, stretches across the
region, and protects business entities.
We as businesspeople in COMESA do not know each
other very well, and we do not have sufficient intelligence
or credit data to make informed decisions, particularly
where Suppliers’ Credit or Joint Venture Investments is
concerned. The question of Credit Reference Bureaux or
a Database of defaulters may need to be housed in an
appropriate institution.
&RQFOXVLRQ
Several areas of concern for the business community in
the past have been addressed by the Authority and the
Secretariat over the past half decade, and it is heartening
to note the plans of COMESA announced or reiterated recently in relation to Investment Guarantees, continuing
trade liberalisation, the increased capitalisation of the
PTA Bank, the creation of a regional communication network, market research, and the improvement of the trade
information network.
Should the Competition Commissions in COMESA be
regional or only analyse 1 supervise an individual country
if we expand the size of the market and the free trade and
investment zone ?
I would like to close by recommending that the business community take a more aggressive, leading role in
breaking the barriers to business in COMESA, and promoting intra-COMESA trade, as well as collaborating to
penetrate external markets, by creating a COMESA Business Network, that should operate under a centralised
Secretariat that would record and incorporate the perspectives and priorities of business leaders from the broad
range of COMESA states. The exchange of information
will enhance the development of this noble objective, and
will assist in drawing the views of those, the business
community, who are expected to lead the implementation
of the COMESA objectives.
,PSDFWRIOHJDOUHIRUPVWRHQKDQFHSURGXFWLYH
FDSDFLW\DQGFRPSHWLWLYHQHVVLQ/'&6
FRPSHWLWLRQSROLF\LQ=DPELD
E\2OLYHU66DDVD
Professor of International Economic Relations
University of Zambia
%DFNJURXQGWRFRPSHWLWLRQODZLQ=DPELD
monopolies in the form of parastatal companies, unless
specific efforts are made to ensure the existence of competition, almost always ends up in monopolistic price rises without corresponding competitive price equilibrium.
This was exactly what obtained in Zambia prior to the
policy of liberalisation.
A number of policy fundamentals ought to be appreciated. Liberalisation entails that the period of government
control has to end, something that the Zambian government has accepted in principle and, to a large measure, in
practice. It is increasingly being recognised world-wide
that monopolistic public providers of infrastructure, social services, let alone business ventures, are unlikely to
succeed in their responsibilities. This means that carefully-designed strategy of private sector entry should be encouraged as it enhances the growth of markets.
0DLQ HOHPHQWV RI =DPELD¶V FRPSHWLWLRQ ODZ DQG
SROLF\
In the context of its policy of economic liberalisation
that benefited from the support of the IMF and the World
Bank, the Zambian government recognised that an active
competition policy remains a key guarantor to economic
efficiency and consumer welfare and contributes to greater availability to the consumer of a broad range of products and services at lower prices. An open competitive environment has also been recognised to fosters innovation
and efficiency, thereby contributing to overall competitiveness of producers. By promoting optimal allocation of
resources, competition policy is seen to contribute to economic growth and development and supports other objectives of macro economic policies.
The central focus of Zambia’s policy of liberalisation
since 1991 has been the switch from the system of central
planning or control of the economy to the use of market
forces as the means of resource allocation. It is anticipated
that the free play of supply and demand would, in the long
run, determine market prices throughout the economy, allowing productive resources to be allocated in an efficient
manner. The country’s structural adjustment programme
(SAP) has been adopted to include market-oriented reforms, particularly in the areas of price deregulation, including the reduction or elimination of subsidies; administrative allocation of key product inputs; privatisation of
public enterprises; and the liberalisation of trade and investment regimes. The main assumption behind the liberalisation policy in Zambia is that, by providing enterprises
with more freedom and stronger incentives, this would
stimulate entrepreneurial activity, business efficiency,
productive investment and economic growth. It is also expected to enhance consumer welfare through improved
quantity and quality of goods and services at prices determined by the market rather than administrative decision
as was the case before.
Against the above background and mindful of the need
to legislate against monopoly formation, the government
passed the Competition and Fair Trading Act in 1994. Until the enactment of this piece of legislation, there has
been no formal enforcement of competition rules and
policy by any institution in Zambia. This Act enabled the
establishment of the Zambia Competition Commission
(ZCC) that is empowered to enforce the competition rules
in various ways.
The Competition and Fair Trading Act states its objectives as follows:
Equally important, the government also recognised
that the benefits of market-oriented reforms are likely to
be fully realised only if enterprises acted under the spur of
competition, so that consumer preferences are reflected in
market responses. It is further recognised that a country
that has undertaken trade liberalisation measures has
every interest in ensuring that the welfare and efficiency
arising from such measures are not lost due to anti-competitive practices by firms. A well functioning market
mechanism is seen as essential in this respect. For example, price liberalisation in the market that is dominated by
• To encourage competition in the economy by prohibiting anti-competitive trade practices;
• To regulate monopolies and concentration of economic power;
• To protect consumer welfare;
• To strengthen the efficiency of production and distribution of goods and services;
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
• To secure the best possible conditions for the freedom of trade; and
• To expand the base of entrepreneurship.
The Zambian competition law as provided for under
the Act focuses on four principal elements of potential
abuse by producers and/or traders. These are (a) horizontal agreements; (b) mergers/takeovers; (c) vertical market
restraints; and (d) abuse of dominant position. They are
briefly elaborated upon below.
+RUL]RQWDO$JUHHPHQWVThese refer to cartel arrangements between firms competing with similar products in
the same market and is effected through, for example,
agreements to fix prices, reduce output, share the markets
amongst themselves, or allocate customers to individual
suppliers in a market. Such an arrangement is considered
unfair to other operators in the market and is being prohibited by the Zambian competition law.
0HUJHUV To the extent that mergers tend to lessen
competition and minimise opportunities for innovation,
the competition law in Zambia discourages their formation. However, the law empowers the Competition Commission to assess the degree to which a planned merger
would compromise competition and, if this is found to be
the case, prohibit its consummation.
9HUWLFDO0DUNHW5HVWUDLQWV This refers to agreements
between operators at different stages of production and
marketing chain and include exclusive dealing (restrictions on a firm’s choice of buyers or suppliers), exclusive
territories (restriction on a firm’s choice of location), lying arrangements (restriction on the source of supplies for
particular inputs used by firms), and resale price maintenance (restrictions on the price to be charged by downstream firms). The Zambian competition law deals with
these restraints as possible instances of abuse of dominant
positions and are covered under Section 7(2) of the Competition and fair Trading Act.
$EXVHRI'RPLQDQW3RVLWLRQThe Act makes a distinction between agreements among firms, on the one hand,
and, on the other, the abuse of dominant position through
exclusive dealing, tied selling, price discrimination, market foreclosure through vertical integration, etc. Firms in
this superior position, due to their market dominance and
financial weight, often tend to determine prices, control
production and/or distribution in a manner that disregards
the market interests of their competitors and, hence, the
Zambian competition law prohibits this behaviour.
6RFLDODQGHFRQRPLFFKDOOHQJHVRIWKHFRPSHWLWLRQODZ
*HQHUDOFRQVLGHUDWLRQV
The impact of the 1994 Competition and Fair Trading
Act on economic efficiency and social welfare is yet to be
seen given the newness of the enforcing Commission, the
Zambia Competition Commission (ZCC), which became
operational only in 1997. A number of generalisations
can, nevertheless, be made, mainly derived from the experience of the liberalisation policy under which competition law finds legitimacy. Competition policy vis-à-vis
competitiveness is typically assessed in terms of ‘HFR
QRPLFHIILFLHQF\’ that entails the combination of productive, allocative, and dynamic efficiency. Market Forces
are evidently the best way to promote economic efficiency to the extent that competitive markets provide strong
incentives for realising this. Competition law enhances
economic efficiency in that it preserves market processes
by preventing a firm engaging in activities which undermine rather than enhance overall economic efficiency. It
does this by establishing the regulatory framework within
which competition and market processes operate. In this
respect, the ultimate objective of competition law is the
promotion of economic efficiency and the assessment of
its impact must focus primarily on this aspect.
In the Zambian case where the state dominated economic activity and the development of the private sector
remained under check, an important precondition to competition is the transfer of state-owned assets to private
hands (i.e. privatisation). The VXFFHVV of the privatisation
policy, in turn, should be measured not so much in terms
of its speed or how many companies have been privatised.
Rather, an important tool for measuring success ought to
be related to the rationale for privatisation, namely, the
need to enhance efficiency, productivity, and competitiveness, aspects that have been absent when the parastatals were predominant in Zambia. It is at this level
where strategic importance of competition finds expression: when the policy of privatisation is coached in terms
of the need to enhance productivity and efficiency, it is often not appreciated that one of the most important factors
that significantly influence enterprise performance, irrespective of who owns it (private or public), is FRPSHWLWLRQ.
The history of British privatisation suggests that rather
than who RZQV the company, it is the competitive environment within which a firm conducts business that
weighs more as the most crucial factor in its performance.
It can, thus, be deduced that the efficiency of an enterprise—public or private—tends to be highest when its
profitability is enhanced in a competitive market; under
managers that are given sufficient autonomy and with capacity and motivation to respond positively and promptly
to competition-induced market signals; and when those
companies that are not able to withstand competition are
allowed to go bankrupt rather than sheltered with preferences and subsidies.
The above argument does not in any way ignore the
characteristic institutional weakness of state-owned and
run enterprises and, thus, the importance of privatisation
and liberalisation. Neither does it imply that privatisation
of state enterprises has no positive correlation with enhanced efficiency and productivity. Rather, the argument
merely cautions against the often popular view that privatisation of ailing state enterprises would necessarily lead
to a miracle transformation of an enterprise from lossmaking to a high output record. The crucial point to appreciate is that it is the presence of FRPSHWLWLRQ that makes
the difference. Indeed, it can be argued that, all things
equal, giving a private firm monopoly control over a particular product or service is less likely to improve efficiency than a public enterprise that is opened up to competition. The putting in place of legislative and regulatory
regime that safeguards competition in a privatising
economy is, therefore, an important step in the enhancement of market efficiency and productivity. This reality
underscores the importance of the existence in a liberalis-
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
ing developing country like Zambia of a coherent and enforceable competition law. It also underlines the need to
entrust the competition authority/commission with the
requisite powers, authority and resources (human, financial, and technical) to effectively enforce the relevant
pieces of legislation that are meant to secure competitiveness.
The Zambian case is a clear demonstration of how undue political control over the activities of parastatals (D)
de-motivated managers to levels that adversely affected
productivity; (E) placed non-economic and commercial
considerations above business principles and interests; (F)
allowed subsidies cover up for bad business decisions; (G)
resulted in suppressed private sector development; and,
consequently, (H) resulted in low productivity/profitability and economic inefficiency. Almost all the state-run
and owned enterprises were operating at a loss and most
of them remained in operation as a result of government
subsidies. A closer examination of the country’s economic performance is made below to demonstrate that the period before competition was introduced recorded, at best,
very insignificant positive growth.
It is noteworthy, furthermore, that before the major
policy reforms of the mid-1980s when a comprehensive
Structural Adjustment Programme (SAP) was attempted,
the Zambian economy’s state-dominated and uncompetitive productive sector was characterised by a lop-sided
structure that was dominated by consumer goods with
very few industries in the capital and intermediate goods
category. Equally revealing, the productive sector in
Zambia has retained the pre-liberalisation legacy of import-intensity at both the raw materials and machinery
levels. In a number of more specialised areas, even labour
has to be imported. Largely due to foreign exchange
shortages that placed a strain on the importation of the required spares, components and raw materials, Zambia’s
industry has suffered from idle capacity long before the
policy of liberalisation was put in place. Much of these
problems were attributable to faulty government policies.
A wide range of policy instruments were employed to
implement the anti-competition and anti-private sector
policies. Firstly, the Zambian government sought to control and influence private investment through a system of
industrial licensing. Secondly, since the country’s major
socialist reforms of 1968 and 1969, the government
placed the parastatal sector as the principal actor in the
economy in order to limit what was perceived as foreign
economic dominance. In line with this policy, parastatal
companies received considerable preference in the issuing of manufacturing and import licenses and foreign exchange allocations. Consequently, by 1980, approximately 50 percent of the manufacturing sector’s output was
accounted for by parastatals.
Secondly, while, on the one hand, the Zambian government extended protection to domestic industry during the
1970s and early 1980s, on the other, it imposed controls
on the prices of a number of manufactured goods produced by both the parastatals and private sector, a phenomenon that demonstrated the state reluctance to allow
the competition-induced market forces to determine the
price of goods and services. The Prices and Incomes
Commission was specifically established for this purpose.
Thirdly, in the pre-SAP controlled regime in Zambia, fairly high nominal tariff rates were set for consumer goods,
particularly those classified as ‘luxury’ ones. At the same
time, low tariff rates were set for industrial inputs. For example, intermediate and capital goods carried very low or
even zero rates of duty. Consequently, a very high rate of
effective protection emerged for the sectors that were involved in the production of consumer goods. During the
mid-1970s, for example, non-food consumer goods in
Zambia attracted as much as 342 percent tariff protection
while consumer durables were awarded 473 percent duty
protection. Low tariff levels were levied on heavy intermediate goods (30 percent); capital goods (60 percent)
and zero/negative rates for what were classified as ‘essential commodities’ such as edible oil, grain mills and fertiliser.
The high degree of protection and the resultant absence
of competition, later reinforced by decreasing capacity
utilisation, had led to decreased efficiency and evidently
escalated costs. In the parastatal sector, this poor picture
was reinforced by weak management and conflicting objectives of profitability, on the one hand, and employment
creation and the artificial promotion of low consumer
prices, on the other. Overall, an industrial sector emerged
in Zambia that was largely composed of firms that were
internationally uncompetitive. They were not only unable
to compete in the export market but also with incoming
imports had the tariffs and other protective barriers been
lowered. This adversely distorted the price structure in the
country.
Fourthly, one of the noteworthy macro-economic
policy in the pre-SAP Zambian economy was the system
of import licensing and foreign exchange allocation. After
1975 and mainly due to foreign exchange shortfalls, the
government placed quantitative restrictions on imports
and put in place an elaborate system of import licensing
and administrative allocation of foreign exchange. The
quantitative restrictions imposed by the import-licensing
and foreign exchange allocation systems, in fact, took
over the function of protecting domestic industry and,
thus, made redundant the role of tariffs in this regard.
Lastly, Zambia’s exchange rate policy during the prereforms period is worth noting. The country’s relatively
high inflation growth rate at the time led to the Zambian
currency (the Kwacha) becoming highly over-valued.
Consequently, there emerged a flourishing parallel market where the unofficial exchange rate was several times
higher than the official one. The various controls and other instruments mentioned above combined to distort business priorities severely. For the average business person
in Zambia, there were huge profits gained in merely securing import licenses and foreign exchange allocations.
For the most part, it was these things that many businesspersons chased instead of attending to genuine productive activities. In a situation of commodity scarcities,
profit margins multiplied such that some industries managed to make net profits even with extremely low levels
of investment and capacity utilisation. Under the above
circumstances, competition and market forces were kept
at bay in business and investment decisions of the predominant state-owned sector.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
What did the above main macro-economic policies entail in general terms? Perhaps the most damaging aspect
of the policy of nationalisation in Zambia was the absence
of competition in the economy. Although it could be argued that the pre-nationalisation privately-owned import
substitution sector had also been characterised by a high
degree of monopoly, this was mainly because of the relatively smaller size of the Zambian market then rather than
a product of state policy. In short, the policy of expropriation of private enterprises by the state and the subsequent
state dominance of economic activity accentuated the
magnitude of monopoly in the economy. Additionally,
the overly centralised state holding companies (i.e., those
that served as umbrella bodies for the nationalised enterprises) were generally unable to provide positive incentives to their companies to improve their efficiency, reduce costs, and enhance profitability, let alone upgrade
the quality of their products.
Similarly, the policy of price control was particularly
damaging to enterprise performance and profitability. In
so far as price control had a high propensity to reduce corporate profitability, this inhibited both new investments
and the ability (and willingness) to finance plant maintenance. From the point of view of the manufacturing sector, price controls in Zambia and the resultant enterprise
inefficiency had tended to place supply at a much lower
level than effective demand. Consequently, the most obvious effect of the pre-liberalisation protective regime in
Zambia was the poor output record that it generated
which, in turn, increased the cost of living due to escalated prices.
Lastly, another policy aspect that has had far reaching
consequences refers to the country’s import intensity.
While this phenomenon did not pose any serious effect on
the productive sector’s performance during the period before 1975 (as export receipts were considerable), the picture changed after that. With the high level of import dependence, the country became extremely vulnerable to
external shocks which came in quick successions, firstly
in 1973 when the price of oil quadrupled and then in 1974
when the first major decline of copper price was registered on the world market (in a country where this commodity accounted for more than 90 percent of the country’s export earnings. As the Zambian economy failed to
adjust positively to cushion itself from those external
shocks, the country’s foreign reserves declined sharply by
1975. An escalation in the balance of payments and budget deficit followed immediately which necessitated yet
another shock, namely, very high and unsustainable levels of domestic and international debt.
Given the generally poor performance of the Zambian
economy during the pre-SAP period as demonstrated
above, the capacity of the formal sector to absorb labour
had been seriously affected long EHIRUH SAP was intro-
duced in a comprehensive way in 1991. The level of employment had declined considerably since 1975 but particularly during the period of adjustment. In 1988, three
industrial sub-sectors registered employment losses,
namely, construction; mining; and restaurants/hotels. The
main explanatory factors behind wage employment losses
during this period was the declining industrial output
record largely due to the factors discussed above. In general, the industrial sector during this period possessed inbuilt structural rigidities that worked against expanded
and sustainable output, a phenomenon that works against
labour retention. The import-intensive nature of the average industrial enterprises; the dominance of the state sector; price controls; and low output all worked against the
emergence of a dynamic productive sector that fully
utilises labour.
(FRQRPLFFRVWVRIDEVHQFHRIFRPSHWLWLRQ
As a consequence of the above poor economic record,
Zambia moved from the 39th position in a list of countries
in per capita GDP ascending order to the 15th position by
1987. Zambia, with per capita income declining to its
lowest at $250, was reclassified from a low-middle to a
low-income country. Figure 1 gives the average GDP
growth rate from 1965 to 1991 when the mew government
embarked upon the policy of liberalisation.
The generally poor economic performance of Zambia’s Third National Development Plan (TNDP) that covered the 1980-84 period reflected the above structural rigidities of the Zambian economy. The TNDP actual
growth rate of only 0.06 percent was well below the anticipated annual rate of 4.8 percent. Much of this decline
was explained by, LQWHUDOLD, the severe decline in investment levels and volume of imports as a result of foreign
exchange scarcity. The actual aggregate investment stood
at only 15 percent as opposed to the planned target of 29
percent of GDP over the Plan period. Furthermore, only
62 percent of the planned import level was realised mainly covering the raw materials needed by the state-dominated manufacturing sector.
Perhaps the worst effect of declining government revenue was felt at the level of capital expenditure whose
1985 share in total government budget (in terms of GDP)
had declined to approximately 9 percent. In real terms, the
1987 government expenditure on capital investments was
more than 70 percent ORZHU than that for 1974. The above
picture tells a lot about the quality and cost of living in
Zambia during this period. From being one of the most
promising economies in Africa during the 1960s and
1970s, Zambia now ranks as one of the poorest. Figure 2
gives figures on government expenditure and revenue and
fiscal deficit during the 1984-89 period. Real 1987
expenditure was actually lower than the 1980 level.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
FIGURE 1
$YHUDJHUDWHRIUHDO*'3JRZWKE\VHFWRU
60
50
3HUFHQWDJH
40
Agriculture
30
Manufacturing
20
Mining
10
Construction
0
-10
Investment/GDP
1965 - 1974
1975 - 1984
1985 - 1988
1989 - 1991
Imports/GDP
-20
<HDU
Agriculture
Manufacturing
Mining
Construction
Investment/GDP
Imports/GDP
2.5
10.1
-3.7
8.6
47.3
-
0.5
1.4
-1.4
-7.5
21.1
32.2
8.3
2.0
-4.8
-3.1
13.4
24.5
-2.1
-1.8
-2.9
-1.2
17.6
19.1
Editorial note: This is the source of the graph in the event that it is preferred.
FIGURE 2
*RYHUQPHQW([SHQGLWXUH5HYHQXHDQG)LVFDO'HILFLW&RQVWDQW3ULFHV
1600
100
1400
90
80
70
1000
60
800
50
600
40
30
400
200
0
1984
1985
1986
3HUFHQWDJH
.PLOOLRQ
1200
Expenditure
Revenue
20
Deficit
10
Recurrent (percentage)
0
Capital (percentage)
1987
<HDU
6RXUFH: Derived from Economic Research Group (1989), Analysis of the 1989 budget of Zambia,
Perspectives on the Zambian Economy, Working Paper Series, Lusaka, Institute fro African Studies.
Expenditure
Revenue
Deficit
Recurrent (percentage)
Capital (percentage)
917
692
226
88
12
1173
713
460
91
9
1340
793
548
82
18
952
715
238
89
11
Editorial note: This is the source of the graph in the event that it is preferred.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
The above developments in Zambia marked the beginning of a major crisis as the economy declined considerably. It was this state of affairs that the government reacted to in its effort to manage the situation and the decision
to embark on the IMF and World Bank-supported structural adjustment programme (SAP), in general, and the
enhancement of competition, in particular, should be seen
against this background.
The first couple of years after 1991 when the new government took over and consolidated the policy of liberalisation registered a declining economic trend as the private sector was still adjusting to the new policy regime.
The value of the manufacturing output declined by 10 percent in 1991 as opposed to the 7.8 percent increase the
previous year. All indicators attribute this poor performance record to the sector’s under-utilisation of its installed capacities, principally a function of a number of
factors that included
• Foreign exchange scarcity and SAP’s fiscal stringency;
• Reduced ability by most investors to import the required raw materials and equipment in a country
whose productive sector has been import-intensive
for close to 30 years;
• Slow progress in the rehabilitation of machinery and
plants;
• Liquidity problems faced by producers emanating
mainly from low profit margins and restrictive escalated interest rates on commercial loans; and
• Uncertainty among parastatal firms regarding the
privatisation process.
The above poor industrial performance has had a
negative impact on the country’s export performance.
Persistent unfavourable balance of payments had continued. For example, accounted in US dollar terms, export
receipts declined considerably in 1992 while imports had
risen. Thus, whereas Zambia’s trade surplus in 1991 was
estimated at $357.3 million, this declined by 60 percent to
only $146.3 million in 1992. Considering that the investment income and non-factor services were in deficit in
1992, a deficit of $315.7 million was recorded for the current account of the balance of payment. This was equivalent to 14 percent of the country’s GDP in that year. Additionally, Zambia’s export earnings declined from
$1,103.3 million in 1991 to $965.9 million in 1992, a significant 12.5 percent fall. For the non-traditional export
sector (i.e., non-copper exports), export receipts declined
from $68.1 million in 1992 against $116.8 million for the
previous year. At the same time, the value of Zambia’s
imports grew to $819.6 million in 1992, a 9.8 percent increase over the 1991 figure. This trend continued into
1993. Thus, several years into SAP, economic recovery
was still illusive.
Another important development worth noting during
the 1991-93 period has been the continuation of the decline in the level of formal sector employment. Between
March and December 1992, for example, retrenchment
claimed 34,000 jobs out of which 15,000 was accounted
for by those from the central and local government sector.
The trend has continued into 1993 when the government
launched the Public Service Reform Programme in November 1993 that includes plans for major reductions in
public sector employment. For the parastatal sector, when
the policy of liberalisation took hold, many of them had to
be liquidated (rather than privatised) since their equipment was obsolete due to many years of poor maintenance
and under-capitalisation.
The above analysis attempted to demonstrate that the
period of controls and limited market openness (the main
indicators of the absence of competition) revealed a very
poor economic performance record in Zambia. While it is
true that not all the problems catalogued above are principally explained by the absence of competition, it is equally true that market openness would have brought in the
requisite competitiveness that is generally acknowledged
to be so vital for economic efficiency and productivity enhancement. Indeed, the Zambian case shows that after privatisation was initiated and most of the state companies
were privatised and/or liquidated, several positive developments have been registered: (D) the contribution of the
private sector to GDP has been increasing; and the economy’s overall productivity has improved, albeit sluggish
due to several factors that include the high inflation
growth rate and a severe foreign exchange scarcity in an
import-intensive economy. By 1998, the investment by
the private sector increased to 10 per cent of GDP, compared to only 5.5 per cent prior to reforms in 1991.
More private sector-led positive changes have been
registered. The liberalisation of the financial sector saw
the emergence of over 20 commercial banks that are operational; and several non-bank financial institutions such
as insurance companies pension funds, the Lusaka Stock
Exchange (LuSE), and the Securities and Exchange Commission (SEC) were established to provide the needed financial intermediation and investment security. The liberalisation of access to foreign exchange added a further
stimulus to the private sector entry as well as the significant reduction in non-tariff barriers to trade. Furthermore,
the opening up the economy to competition has removed
the inefficiencies and distortions that were associated
with the former protectionist economic regime. The playing field is also sought to be levelled for all competitors,
domestic and foreign and, in this process, the casualties
would be all those firms which were hitherto earning huge
rents simply by obtaining import licenses and foreign exchange allocations and receiving implicit ‘subsidies’ from
Zambian consumers by charging internationally uncompetitive prices.
The introduction of competition in the foreign exchange market further brought significant improvements
in the country’s foreign trade sector. External trade performance in Zambia has been closely linked to the country’s exchange rate policies. The experience of the country over the years confirms the strong correlation between
export volumes and the real exchange rate. The economic
dividends derived from competition enhancement in
Zambia is perhaps best revealed in the non-traditional (i.e.
non-copper) export sector. Under the liberalised and competitive economic climate of the post-1992 period, nontraditional exports, principally contributed by the private
sector, have been growing considerably. Figure 3 shows
the overall healthy performance of non-traditional
exports.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
FIGURE 3
3HUIRUPDQFHRI1RQ7UDGLWLRQDO([SRUWV
(US$ million)
400
350
300
250
200
150
100
50
0
1990 1991 1992 1993 1994 1995 1996 1997 1998
The stronger than forecast export performance since
1995, thanks to the policy of liberalisation and competition enhancement, principally explains the sharp contraction in the country’s current account balance-of-payments
deficit that declined to US$104 million in 1997, its lowest
since 1993. The positive private sector response to liberalisation has also been witnessed in the agricultural sector. The impact of the policy of market liberalisation has
been quite significant. To start with, private traders’ entry
into marketing was almost immediate following the policy
shift although this introduced some transitional difficulties.
As an earlier evaluation noted,
Private traders emerged in response to market liberalisation; 47.3 per cent of all produce by the small-scale
farmers in 1994/95 was sold to private traders, compared to 10 per cent sold to the co-operatives… Private-led contract farming under which credit is given
in-kind to smallholders by private firms has emerged
to replace government-sponsored credit.1
&RPSHWLWLRQDQGWKH&KDOOHQJHRI60(V
How does competitiveness, in general, and Zambia’s
Competition and Fair Trading Act, in particular, affect
small- and medium-scale enterprises (SMEs)? There are
several positive points. Firstly, to the extent that competition enhances productive and allocative efficiency, its
ORQJWHUP benefits are expected to maximise economic
and social welfare. In particular, structural adjustment
processes, in general, and competition in a liberalised
economic regime, in particular, has the potential, in the
long-term, to facilitate the opening up of new production
opportunities for SMEs especially when looked upon
against the background of Zambia’s past restrictions on
domestic and external trade and price controls. In the
Zambian case, the highly regulatory economic policies
that were adopted during the pre-1991 period principally
explained the low productivity of the economic sectors,
including SMEs. Hence, a shift from government regulation of the economy to a more market-based and com1
INESOR (1996), Zambia: Agricultural Sector Performance
Analysis, Lusaka, MAFF, August, pp. 10-11.
petitive policy regime would necessarily create the much
sought out enabling environment that would ultimately
free productive resources to respond competitively to
market signals. A more market-based policy climate
should, thus, be seen as essential for the development of
productive enterprises, including SMEs.
In theory, deregulation-cum-competition contributes
to the development of SMEs at two levels: (D) productive
gains through improved efficiency; and (E) lateral expansion due to the enabling environment created for the establishment of SMEs. These two benefits are derived
from such liberalisation policies as the relaxation of protracted investment approval procedures; price decontrols;
and freeing of labour market regulations. Similarly, the
open competitive trading system has resulted in the availability of, and/or easier access to, better quality inputs
which should allow SMEs in Zambia to improve and diversify their areas of activities, thus, creating new production opportunities for the sector. This would also allow for
easier adjustment to changed market conditions.
Notwithstanding the above advantages that are associated with competition, there are still a number of outstanding challenges and/or costs. Firstly, at the macro level and in the transitional, short-term, a number of factors
and elements must be in place in Zambia, as in other
LDCs, to facilitate the anticipated economic efficiency
gains emanating from competition enhancement. They include the following:
• The existent of a fairly developed market (as opposed to ‘LPSHUIHFWPDUNHW’);
• The presence of a well-developed private sector with
entrepreneurs that have the capacity to respond
promptly to market signals;
• The existence of regulatory and legislative atmosphere, including enforcement capacity, that provides
the needed regulations; and
• Economic stabilisation that induces relatively efficient operation of the privatised enterprises.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
In the Zambian case, the above pre-requisites to the
maximisation of benefits from competition are hardly developed and the expected responses to free market-induced changes are often not forthcoming. In this country,
entrepreneur development is still in its infancy; the markets are often imperfect in important respects; the legal
and regulatory infrastructure that safeguards competitiveness (e.g. ZCC) is still undergoing the process of development and refinement amidst institutional and human resource capacity limitations; and economic stabilisation
still remains illusive despite externally-supported structural adjustment.
Secondly, there still are weaknesses in the competition
law that compromise the development and consolidation
of SMEs. Perhaps the most immediate challenge is that
the Competition and Fair Trading Act does not make a
distinction between the different sizes of enterprises, a
phenomenon that seems to suggest that all enterprises,
large and small, local or foreign, productive or trade-oriented, are treated the same under assumed perfect market
conditions. And yet, given the initial conditions and circumstances prior to liberalisation as earlier discussed and
under which SMEs operate, the country’s competition
policy needs to acknowledge the existing distortions so as
to address positively the adverse distribution effects of
market liberalisation. Some form of discrimination in favour of SMEs would seem to be justified to enable them
attain a certain degree of competence and efficiency under a liberalised market. The conditions under which
SMEs operate in Zambia today demand that the legal and
regulatory regime has to recognise their peculiar circumstances and offer some preferences if their productive capacity is to be enhanced, in the short-term, so that they become competitive, in the medium- to long-term. The main
characteristic inhibitions that presently compromise
SMEs in Zambia to fully get into the liberalised market,
let alone to become competitive, include the following:
• Lack of capital and access to credit;
• Limited technical and managerial skills;
• Inadequate business premises and infrastructure;
• Lack of diversified markets and market information;
• Lack of technology and access to relevant technological information;
• Unfavourable policy environment, including legal
restrictions; and
• Inadequate institutional framework.
Under the above state of affairs, one observes that although the long-term benefits of the policy of liberalisation are clear, the short-term adverse effects of a comprehensive SSE exposure to full-scale competition (that
includes competition with in-coming imports) have remained a major challenge for Zambia. In the light of this
realisation, there is growing recognition that the process
of creating a fully-fledged competitive market in Zambia
would take time especially under conditions where private sector development, particularly as it relates to
SMEs, has been held hostage to a legacy of past inhospitable state-market relations. One crucial consideration
here is that, in the short-term, market liberation tends to
be disruptive particularly in countries where the policy regime for a long time disregarded market considerations in
the determination of prices for inputs and outputs. SMEs’
income levels have generally remained low and many of
them are actually closing down due to the fact that liberalisation in Zambia has entailed sudden increase in input
expenditure almost across the board following government withdrawal from the provision of inputs and credit
facilities. This is not to say that government withdrawal is
a bad thing. Rather, this merely recognises that the withdrawal, if not properly sequenced and when its speed is
not aligned to the capacity of the domestic private sector
to fill up the void left open by the retracting state, serious
short-term adverse effects on the productivity and general
performance of SMEs ensue. Although, for example, the
Zambian government’s withdrawal from the delivery of
credit2 is understandable in a country that is passing these
responsibilities to the private sector, this has led to a crisis
especially given the slow response from the still budding
private operators to take over this responsibility from the
state, a development that has resulted in the cost escalation of vital inputs for SMEs. This seems to suggest the
importance of adopting a phases and properly sequenced
approach in the integration of SMEs in the all-encompassing competition policy.
Under the above conditions, the main national challenge at the policy level is to work out how best to help
SMEs improve their productivity and competitiveness
through institutional, regulatory, and legislative mechanisms but in a manner the recognises their intrinsic disadvantages relative to the larger size competitors on the
market, including direct foreign investors, particularly the
more market-dominant transnational corporations that often stifle free competition. From the above analysis, it is
clear that, presently, the conditions are evidently uncertain regarding the degree to which purely market forces
and the enhancement of competition, at least during the
transition, would alone automatically improve SMEs’
productivity.
The third challenge is Zambia’s introduction of external trade liberalisation (as opposed to domestic competition policy) with little consideration of the speed and degree to which the country’s main regional trading partners
are doing the same. This last point is particularly important for Zambia. Although FRPSHWLWLRQODZ relates principally to regulation of producers and traders in the domestic market (as opposed to WUDGHODZ that mainly regulates
external trade policy), the nature of the ‘land-locked’ and
import-intensive Zambian economy and how it has interacted with the regional economies is such that the two
laws are so intertwined that it would be superficial to address their concerns independently. This challenge, that
comes closer to a cost of competition, has to do with the
extent to which the government’s elimination of trade restrictions and liberalisation of financial markets may have
resulted in the clouding out of the domestic market with
competing imports, a phenomenon that is generally assumed to threaten the survival of local industries, includ2
For example, the state has withdrawn from the provision of agricultural credit following the closure of the Lima Bank. The credit facility
under the Small Enterprises Development Board (formerly Small
Industry Development Organisation) has also ceased.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
ing SMEs. Many producers in the country today complain
that they are being unduly exposed to ‘XQOHYHOOHGSOD\LQJ
ILHOG¶ in their intra-regional trade interaction, particularly
with South Africa and Zimbabwe that have not yet opened
up their trade regimes (including exchange controls) to
the same degree. Hence, it is generally argued that Zambian producers/exporters are being subjected to XQIDLU
FRPSHWLWLRQ(see next section).
Notwithstanding the validity of the above concerns, a
closer examination suggests that the ‘clouding out’ argument ought to be taken with caution when the effects of
trade liberalisation are examined with respect to SMEs.
First, since the devaluation of the Zambian currency has
made imports dear, this must have reduced the ‘external’
threat from incoming imports, especially considering the
fact that the products of SMEs appeal more to the low income groups that can least afford expensive imports.3 Indeed, what is likely to happen is that the short-term demand contraction that has resulted from the structural
adjustment’s cost recovery measures would overshadow
the current worries, thus, limit the anticipated violent
fluctuations in the demand for SME products.
Similarly, while competing imports may be harmful to
SMEs in the short-term, the Zambian experience so far
suggests that this is more so only for particular sectors.
The clothing and textile sector, dominated by numerous
SMEs, is perhaps the worst hit by the immediate effect of
trade liberalisation. Cheaper imported textiles and garments, including second-hand clothing, have so far resulted in a very high rate of factory and retail outlet closures.
7KHFKDOOHQJHRIWUDGHOLEHUDOLVDWLRQ
The above analysis of competition enhancement vis-àvis SMEs suggests that the speed of liberalising markets
ought to be guarded and aligned to the country’s capacity
to manage the needed regulations. In the financial and
trade sectors, for example, a word of counsel from the
World Bank’s most resent annual report, *OREDO(FRQRP
LF3URVSHFWVDQGWKH'HYHORSLQJ&RXQWULHV is instructive in this regard for countries like Zambia that has
completely removed all foreign exchange controls.4 The
Report warms that the poor countries are in for theirworst
time since the 1980s debt crisis and recommends caution
in liberalising financial markets. “Excessive zeal in deregulation” in countries lacking strong institutions and
policies to manage private capital flows was largely to
blame for the financial crises that began in Asia in 1997
and spread to Russia and Latin America, says the Report.
‘Excessive zeal’ in Zambia’s liberalisation is evident at
the level of tariff reduction relative to its regional trading
partners. Despite the policy of liberalisation analysed earlier, most of the trade and investment problems still persist. Most manufacturing firms, particularly those in the
small- and medium-scale categories continue to face liquidity problems and lack of funds for investment while
trading has become more attractive than before. What has
3
Note that 70 percent of the Zambian population is classified as
‘poor’.
4
By. January, 1994, the government had completely liberalised the
financial markets. The suspension of the Exchange Control Act in that
year completed the liberalisation process in this field.
caused these problems appears to be the speed and manner of policy implementation. Trade liberalisation is one
prominent example where adequate attention was not
paid to the policy trade-offs. In 1991, the government reduced the number of tariff rates from eleven to six and the
new minimum and maximum tariff rates were set at 15
percent and 50 percent, respectively. There were only a
few exceptions in the form of a small number of luxury
goods which were subject to 100 percent duty. The objective of these measures was to simplify the tariff structure
to allow for freer trade and better revenue collections. A
year later, further simplifications followed. By 1995, the
system carried only three tariff rates with 40 percent applied on finished import products and 30 percent or 20
percent applied on intermediate products or raw materials. Also, many goods were zero-rated. The 1996 government budget set the tariff bands at 0, 5, 15, and 25 percent.
There is a standing commitment to reduce these further in
the future. It is clear that these big changes in the tariff
structure, much as they are commendable particularly in
the context of the missions of such regional integration
schemes as the Common Market of Eastern and Southern
African States (COMESA) and the Southern African Development Community (SADC), as well as in the context
of the ideals of WTO, they seem to have been implemented with too much swiftness especially in the light of what
takes place in the county’s major regional trading partners.
It is the above speed of the trade liberalisation that has
caused concern to Zambian manufacturers who have
complained of the rapid opening up of the Zambian market to foreign imports especially from the COMESA region and South Africa and have maintained that it has rendered the playing field ‘unlevelled’. In particular, their
complaints have been directed at South Africa which offered for a long time export subsidies of up to 20 percent
and at Zimbabwe which has placed a number of bureaucratic non-tariff barriers making it difficult for Zambian
products to enter its markets. The validity of these complaints is partially borne out by the statistics that indicate
a growing negative balance of trade with Zimbabwe and
South Africa. For example, in 1993, South African exports to Zambia were of the order of $360 million while
Zambian exports to South Africa were valued at a meagre
$15 million.
7KH3ROLF\LPSOHPHQWDWLRQFKDOOHQJH
In the light of the above-discussed challenges and
contradictions, the actual implementation of Zambia’s
competition law poses major difficulties at the level of
both policy-cum-strategy and institutional capacity. Additionally, the constraints faced by the Zambia Competition Commission should also be looked at in the light of
historical events and the change in the structure of the
Zambian economy. The adoption of the structural adjustment program entailed a number of changes in the policy
domain pertaining to, LQWHUDOLD, privatisation, investment
and competition policies. However, from the above
analysis, it is clear that the pace of the privatisation policy
in Zambia has not matched that in areas of (D) competition
and fair trade policy and (E) investment policy. The problem seems to have stemmed from the failure of the government system to implement these policies on a parallel
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
basis (rather than sequentially as has generally been the
case). Buyers of firms that were sold through the privatisation process and who had incentives to form monopolies were initially not subjected to fair trade and competition regulations. They could form strategic alliances with
the end objective of transferring assets to each other and
ultimately forming monopolies. In the setting of a parallel
and somewhat disjointed development of privatisation
and competition policy, such hidden motives can be mitigated by the enforcement of legislation on the part of
ZCC. There are many restrictive trade agreements especially between dominant companies in the supply of
goods and services e.g. exclusive distribution agreements,
territory exclusivity agreements, price maintenance
agreements, and price fixing agreements. The Commission is currently going through a review of these to ensure
that they are aligned to the anti-monopoly legislation, a
process that could have been forestalled had the sequencing of legal reforms to enhance competitiveness been
appropriate in the first place.
It is equally noteworthy that competition policy was a
new issue in the Zambian environment, thus, partially explaining the apparent sequencing difficulties. The setting
up of ZCC revealed existing gaps in human resource capacity to enforce and manage such a policy and these gaps
still persist. Support from government has been mild due
to the apparent inability to relate competition policy to
overall developmental goals. This also largely explains
the delay in the setting up of ZCC. Although the Competition and Fair Trading Act was enacted in early May,
1994, it only came into force in February, 1995. The
Commission itself was not established until April, 1997.
In the meantime, considerable level of investments and
privatisation was on-going following the passing of the
Privatisation Act in July, 1992 and the subsequent establishment of the Zambia Privatisation Agency. The Investment Centre was established shortly after the passing of
the Investment Act as early as 1991, later revised in 1993
to facilitate equal treatment of local and foreign investors.
By January, 1996, over a year EHIRUH the Commission was
established, 102 companies had already been privatised;
the assets of 10 non-performing parastatals had been sold;
and 100 companies had been restructured to facilitate
their privatisation.5
It is evident that the Zambia Competition Commission
should have commenced its operations at the same time as
the Zambia Privatisation Agency (ZPA) in 1992. The
problems of competition were actually foreseen during
the enactment of the Privatisation Act in which it is clearly specified that during the privatisation of state owned
companies, ZPA shall ensure that monopolies are not created in the process of privatisation. Indeed, it was acknowledged during the privatisation process that if the sale
of the state owned enterprises was not carefully planned,
the whole privatisation exercise may end up transforming
the state monopoly into a private monopoly. Despite this
recognition much earlier in the process of privatisation, it
was clear that the enabling legislation to safeguard this
was not put in place.
Because of the ‘after-thought’ character of the formation of ZCC, the rather belated expectation for compli5
GRZ, 1996 Budget Speech, Lusaka, 1996.
ance from the business community has not been well received and there is little sign that private entrepreneurs
appreciate the role of regulatory bodies such as the Commission as evidenced by minimal representation made to
it on issues of fair trade and competition policy.
$GGLWLRQDOHIIRUWVIRUJXDUDQWHHLQJSROLF\FRKHUHQFH
So far, there is no major incoherence with respect to
the Zambian competition policy and law. There are,
nevertheless, a few areas that call for some reflection.
Specifically with respect to the Zambian competition law,
one observes that, if mishandled, some provisions of the
Competition and Fair Trading Act would unduly restrict
firms’ ability to freely compete. Part III, Section 7 of the
Act, for example, prohibits “…mergers, takeovers, joint
ventures or other acquisitions of control whether of horizontal, vertical or conglomerate nature…” Under a normal competitive environment, takeovers and joint
ventures are normal and unless something sinister is
established, a blanket prohibition of this in a liberalised
economy seems inappropriate.
It is worth observing that, under specified circumstances, the Act provides for exemptions to the law. Although Part III of the Act prohibits conduct that compromises competition, exemptions are given on the ground
that full competition does not necessarily/always deliver
the desired outcomes. The Act’s adjudication (Authorisation and Notification) procedures give authority to ZCC
to grant immunity from legal proceedings for conducts
that may breach the Act. Such authorisation is possible if
the Commission, after investigations and consultations,
concludes that the public benefit from an otherwise prohibited behaviour exceeds the anti-competitive effect.
The lack of clarity over the issue of which merger or
takeover is allowable and which one is not raises the question of policy coherence as the final decision is left to the
capacity, integrity and competence of ZCC to investigate
and interpret the special circumstances of each case. Considering the newness of the Commission; the limited financial, information, and human resources at its disposal;
and the powerful and influential attributes of some of the
firms it has to deal with (especially multinational corporations), it would seem inappropriate under the Zambian
circumstances to leave the final decision on whether or
not to allow a merger to the sole interpretation of the
Commission. To preserve its coherence and integrity, the
competition law should guide the Commission, in a more
precise manner than is the case in the current legislation,
regarding the types or forms of mergers or takeovers that
are not permitted. This is particularly important as mergers per se are not intrinsically bad especially since, in an
economy that is still consolidating its private sector, they
could be one means of achieving efficiencies, particularly
where increased exposure to global markets is placing
pressure on generally weak and smaller domestic firms to
reduce costs; improve quality and service; take advantage
of economies of scale; and innovate in order to become
more competitive in those markets.
Lastly, the coherence of the competition policy reforms is, to an overbearing degree, dependent on the capacity of the government to enforce its competition law.
This, in turn, is dependent on the capacity of the law
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
enforcement institutions, particularly ZCC in this case, to
access the requisite financial, human, and technical resources that would allow them to secure the business
community’s adherence to the provisions of the law of
competition and fair trading. At the financial level, the
Commission requires sufficient resources to enable it implement its mandate. Presently, fiscal stringency across
the Zambian public sector has crippled the realisation of
many policy ideals. If ZCC would have to stand any
chance of facilitating the provision of legal and regulatory
infrastructure that is necessary for productive capacity
and competitiveness, the government needs to provide the
requisite finance.
At the level of human resources, ZCC presently has a
staff of only 18 professionals.6 One of the most important
aspects of institutional capacity regards the role of human
resources in management. Presently, with the slowness in
the implementation of the Public Service Reform Programme, the government has generally been unable to recruit and retain the needed well-trained and skilled manpower. The public sector’s low salaries; poor conditions
of service, particularly for professionals; and a largely uncompetitive working environment have all worked
against the creation and consolidation of the required professionalism in strategic sectors. There has also been a
tremendous erosion of real wages over the years. Under
these conditions, one hopes that special incentives shall
be created for ZCC professionals to enable them provide
the needed facilitation of a hospitable competitive business environment. Capacity is required, for example, to
effectively review the existing trade agreements with a
view to aligning them to the provisions of the Competition and Fair Trading Act. This is because there are still
many restrictive trade agreements especially by dominant
companies in the supply of goods and services.
Against the above background, ZCC faces a formidable task in building its own capacity to undertake a catalogue of responsibilities as well as raise awareness and
support for competition policy among the general public
and the business community. The existence of a ‘competition culture’ within the country is vital to the success of
the Commission’s work and ultimately to the effectiveness of the competition law. There is recognition that
competition enforcement can only be effective if the business community and the people at large are supportive. In
this regard, the Commission’s current areas of concentration include the following:
• Providing as much information as possible to the
public about the activities of ZCC (mainly through
workshops);
• Educating the consumer and the business community about competition law and how it is enforced;
• Developing public support for enforcement, by demonstrating how consumers benefit from an effective
competition policy; and
6
ZCC has 10 economists, 5 accountants and administrators, and 2 legal officers. Unless the Commission has sufficient resources to subcontract out some of their tasks as provided in the enabling legislation,
the core staff of only 18 seems to be inadequate.
• Safeguarding consumer welfare through its consumer complaints desk that has been set up to handle
these and similar issues.
5HFRPPHQGDWLRQVIRU/'&V
A number of lessons can be derived from the Zambian
case regarding the capacity of competition policy and related legal reforms to enhance productivity and competitiveness in developing countries. Firstly, it is evident that
liberalisation does stimulate entrepreneurial activity,
business efficiency, productive investment and economic
growth which, collectively, result in the enhancement of
consumer welfare through improved quantity and quality
of goods and services at market-determined prices. Secondly, competition also fosters innovation and efficiency
in a manner that promotes the competitiveness of producers. Thirdly, it is also a truism that competition enhancement is best realised when the private sector, rather than
the state, is allowed to dominate production activities,
thus, underlining the importance of privatisation in any
developing country that aspires to implement competition-enhancing policy measures.
In the light of the above, it is important to ensure that
the welfare and efficiency gains from liberalisation are
not lost through anti-competitive and monopolistic practices by firms. Legal reforms that focus on competition
law are, therefore, crucial for economic efficiency to the
extent that, if well enforced, they preserve competitive
market processes by checking anti-competition practices
in the interest of overall economic efficiency. In this regard, the ultimate goal of competition law should be the
promotion of economic efficiency.
Specifically with respect to SMEs, a number of recommendations are noteworthy. Firstly, notwithstanding the
merits of the above conclusions, it is important to recognise that not all countries are at the same stage of private
sector development and that they face different challenges in their quest for economic efficiency and productivity. This means that the pattern and speed of liberalisation and competition promotion ought to be aligned to the
peculiar circumstances in the country prior to the needed
reforms. The relative competitiveness of SMEs in a liberalising economy, for example, is conditioned, to an overbearing degree, by their peculiar constraints and market
position relative to the more established firms, particularly foreign direct investors. In countries similar to Zambia,
a further challenge is brought about by the crippling effects of in-coming imports under conditions that are not
always favourable to SMEs, a phenomenon that gives further credence to the importance of ensuring that the speed
and sequencing of market liberalisation are in tune with
what obtains in the country’s major trading countries, particularly at the regional level. A phased approach to liberalisation in the implementation of competition policy is,
therefore, recommended under these conditions.
Secondly, considering the fact that the dominant position of large-scale local and foreign firms checks the
smooth entry of SMEs into the marketplace in a competitive manner, it is recommended that some form of discrimination in favour of the latter is made to enable them
attain a certain degree of competence and efficiency
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
under a liberalised market if their productive capacity is
to be promoted, in the short-term, so that they become
competitive, in the medium- to long-term. This should
help in addressing positively the adverse distribution effects on SMEs of unregulated competition.
An equally important lesson learnt from the Zambian
case is that the promotion of competition through institutional and legal reforms entailed a number of changes in
the policy domain pertaining to, among other things, SUL
YDWLVDWLRQLQYHVWPHQWDQGFRPSHWLWLRQ policies. Because
of the multi-faceted nature of the challenges, it is recommended that the pace of FRPSHWLWLRQ and fair trade policy
in LDCs must be aligned to, and concurrently managed
with the policies regarding SULYDWLVDWLRQ, and LQYHVWPHQW.
In this regard, it is recommended LDCs should implement
these policies in parallel to each other rather than sequentially. The timing of the enactment of the competition
policy and legislation should also recognise the interrelationship between these elements.
Another important consideration relates to the coherence of the competition-enhancing legal reforms, in general, and what is provided for in the enabling pieces of
legislation, in particular. In order to ensure that the provisions of competition law do not unduly restrict firms’
ability to freely compete and that their enforcement does
not leave too much to the interpretation and discretion of
the overseeing authority, the law should be explicitly
clear on what is allowable/exempted and under what circumstances. This is particularly important for most LDCs
considering the newness/inexperience of the institutions
tasked with the responsibility of competition enforcement; the limited financial, information, and human resources at their disposal; and the power and influence of
some of the firms (particularly transnationals) whose
activities they have to monitor and regulate.
The above recommendation calls LDCs to address capacity building aspects of law enforcement. Apart from
the need for the existence of a conducive regulatory and
legislative atmosphere, the capacity of LDC governments
to enforce the competition policy and laws is quite fundamental in translating the legal reforms into positive economic change. In this regard, the legal and regulatory infrastructure/institutions that safeguard competitiveness
need to be developed and consolidated by attending to, LQ
WHUDOLD, their human, financial and technical capacity limitations. Governments should, thus, allocate more resources to the institutions that are charged with the
mandate of competition policy enforcement.
(QVXULQJFRQVXPHUEHQHILWVIURPFRPSHWLWLRQLQJOREDOL]LQJPDUNHWVDQGFUHDWLQJ
DFRPSHWLWLRQFXOWXUHVXSSRUWLYHRIGHYHORSPHQW
%\*HUDOGLQH)RVWHU
Special Advisor to CARICOM
:K\WKHQHHGIRUFRPSHWLWLRQOHJLVODWLRQ
(E) the approach which should be taken by developed
nations towards small island economies in a multilateral
trading context in light of certain economic realities.
Over the past twenty (20) years, the world has witnessed a trend towards economic liberalization. Many developed and developing countries have begun to emphasize decentralized competition rather than centralized
state direction as a means of determining the production
and distribution of goods and services.
However, to ensure a proper understanding of the issues, it would be useful to discuss the Act itself and the
functions of its administrative agency, the Fair Trading
Commission.
It has become widely accepted that the adoption of a
free market system holds the best prospect for Jamaica’s
economic development and improvement in the welfare
of its citizens. This recognition led the Jamaican government to introduce a number of policy measures popularly
associated with such terms as liberalization, deregulation,
divestment etc. A similar outlook may have precipitated
the move to formulate competition legislation in your
various territories.
7KH)DLU&RPSHWLWLRQ$FW
The Fair Competition Act (FCA) was enacted on
March 9, 1993 and came into effect on September 9,
1993. The legislation establishes an agency known as the
Fair Trading Commission (FTC or Commission) that is
empowered to enforce the provisions of the Act. The Act’s
primary objective is to provide for the maintenance and
encouragement of competition in the conduct of trade,
business and in the supply of services in Jamaica with a
view to providing consumers with competitive prices and
product choices.
What the government of Jamaica hopes to achieve is
the promotion of a free market economy with the attendant benefits, namely, (D) the efficiency which results from
competing firms; (E) lower prices and more choices for
the consumer; (F) better products and services; and (G) increasing opportunities for existing and new businesses.
The FCA applies to all activity in relation to the conduct of business in Jamaica. However, there are certain
exceptions. These many be itemized as follows:
(D) collective bargaining;
It has also been recognized that the gains from the operation of a free market can be subverted if care is not taken to ensure that certain controls are put in place. The
passing of the Fair Competition Act in 1993 and the establishment of its administrative body, the Fair Trading
Commission, demonstrate a clear understanding of this
reality.
(E) patents/ trademarks;
(F) conduct authorized by the Commission;
(G) activities expressly approved or required under
any treaty or agreement to which Jamaica is a party; and
H) any activity exempted by the Minister and there
after ratified by Parliament.
The Fair Competition Act was put in place to ensure
competition in the conduct of business in Jamaica. All legitimate business enterprises must have an equal opportunity to participate in the Jamaican economy. Additionally,
the consumer ought to have the benefit of adequate and
relevant information, and be afforded meaningful choice.
&RQGXFWSURKLELWHGE\WKH$FW
3ULFH )L[LQJ—by contract or other agreement or arrangement.
In Jamaica, benefits have clearly been recognized.
More importantly, however, those involved in the enforcement of the Fair Trading Act have seen first-hand
that in a developing economy, certain complaints predominate, hence rendering particular provisions in the
law more applicable than others. This paper will attempt
to address, LQWHUDOLD:
%LGULJJLQJ—it is unlawful for two or more persons to
enter into an agreement whereby the persons attempt to
influence who wins the bid by either deciding amongst
themselves that one should not participate in the bid or
agreeing amongst themselves on the dollar amount to be
bid.
0LVOHDGLQJ5HSUHVHQWDWLRQV—a person may not make
a representation to the public that is false or misleading in
a material respect. The representation may be oral or writ-
(D) The complaints in question and the provisions
which render them actionable; and
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
ten and there is no requirement that the person making the
representation intend to mislead. This breach appears
most frequently in matters relating to advertising.
tion and that such abuse has had or is likely to have the effect of lessening competition substantially in the
marketplace.
'RXEOH7LFNHWLQJ—a person shall not supply any article at a price that exceeds the lowest of two or more prices
clearly expressed by him on the article.
The Act states that the enterprise “abuses its dominant
position if it impedes the maintenance or development of
effective competition in a market.” It goes on to outline,
specifically, conduct which would be considered evidence of an enterprise's abuse of its dominant position.
The list in the Act is illustrative only.
6DOHDW%DUJDLQ3ULFH:LWKRXW$GHTXDWH6WRFN
6DOHDERYH$GYHUWLVHG3ULFH
&RQVSLUDF\—any practice whereby one person combines, agrees or arranges with another to limit unduly the
manufacture, transport or supply of any goods or services
or to enhance the price of same or to restrain or injure
competition unduly.
([FOXVLYH 'HDOLQJ—any practice whereby a supplier
of goods requires that his customers interact exclusively
with him as a condition precedent to the supply of the
goods, which in effect protects the supplier from his competitors.
7LHG6HOOLQJ—any practice whereby the supplier of an
article as a condition of supplying the article requires his
customer to, at the same time, purchase any other item.
0DUNHW5HVWULFWLRQ—any practice whereby the supplier
of goods requires that his customer supplies goods only in
a defined market or extracts a penalty of any kind from the
customer if he supplies any goods outside the defined
market.
However, please note that anti-competitive business
practices may be authorized if the Commission is satisfied
that the particular practice provides some overwhelming
social benefit.
6WUXFWXUHYHUVXVFRQGXFWDSSURDFK
One of the critical aspects of competition law worldwide is how the competition legislation purports to deal
with economic concentrations namely, mergers, acquisitions, joint ventures and the like. Jurisdictions must make
a policy decision as to whether their economy is such that
they would wish to prohibit certain economic concentrations as opposed to focusing on the behaviour of existing
entities. This has been known as the structure versus conduct dilemma. For example in the United States where
there is present a huge economy of first world proportions, stress is placed on prohibiting conduct prior to its
practice.
Jamaica has chosen the opposite approach. Its legislation is activated only after a business engages in prohibited conduct. Economic concentrations are analyzed under
the FCA in terms of dominance. In other words, this is
conduct-based legislation. The FCA defines a dominant
company as one which “occupies such a position of
strength in the market as will enable it to operate in the
market without effective constraints from its competitors
or potential competitors.”
However, it is important to point out that simply being
dominant does not constitute a breach of the Act. An enterprise must be found to have abused its dominant posi-
7KH )DLU 7UDGLQJ &RPPLVVLRQ VWUXFWXUH DQG
IXQFWLRQV
6WUXFWXUH
The FTC is comprised of two distinct arms: the quasijudicial arm represented by the four (4) appointed Commissioners, and the investigative arm, of Commission’s
staff, headed by the Executive Director, who directs three
lawyers, two economists, two research officers and a cost
accountant.
)XQFWLRQVDQGUHVSRQVLELOLWLHV
The Commission may carry out, at its own initiative or
at the request of any person, such investigations in relation to the conduct of business in Jamaica as well enable
it to determine whether any enterprise in engaging in business practices in contravention of the Act and the extent
of such practices.
The Commission has a duty to advise the Minister on
such matters relating to the operation of the Act, as it
thinks fit or as may be requested by the Minister. The
Commission also has a responsibility to inform and educate the public with respect to their rights and obligations
under the Act, to undertake studies and to publish reports
regarding matters affecting the interests of consumers and
to co-operate with and assist any body or persons in developing and promoting the observance of standards of
conduct for the purpose of ensuring compliance with the
provisions of the Act.
3RZHUV
The Commission may summon and examine witnesses, call for and examine documents and in certain instances, issue directions to a company that it believes to
be in breach. Specifically with respect to an enterprise's
abuse of its dominant position, the Commission may take
any action it considers necessary. The Commissioners are
empowered to make “findings” in certain cases, those cases being abuse of dominance, exclusive dealing market
restriction and tied selling. In this regard they behave very
much like judges. In other matters, the Commission will
have to take the entity charged to court.
3URFHGXUH
The FTC is a law enforcement agency. In practical
terms, this means that the Commission is not the adjudicator of individual disputes but rather it seeks to address
matters of national interest.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
A complaint is received by the Commission and is investigated or an investigation may be initiated internally.
If the investigation reveals to the Commission’s staff that
a breach of the FCA has occurred, then the staff will usually recommend certain remedial action to the Company
in an effort to resolve the matter in a non-adversarial manner. If, however, the company is reluctant to co-operate
with the Commission’s staff, it may be served with a Notice of Examination to appear before the Commissioners.
Acting in their quasi-judicial capacity, the Commissioners will then meet with the company to determine the
cause of the lack of co-operation and inform the company
of the Commission’s expectations with a view to settling
the matter. If settlement seems unlikely, the staff requests
the Commissioners’ approval to take the matter to Court
so that the issues may be adjudicated.
Not all matters are handled in the first instance by the
court. Breaches of section 20 (abuse of dominance) and
section 33 (market restriction, tied selling and exclusive
dealing) of WKH$FWare determined firstly by the Commissioners who sit as judges at a public hearing and make
findings based on the evidence presented by both sides.
Should the Commissioners find in the staff’s favour, they
may issue any directions to the company they deem
appropriate to correct the breach.
If the Commissioners acting in their judicial capacity
find a breach of section 20 and/or 33 of the Act, the company has up to fifteen days from the date of the finding to
appeal to a Supreme Court Judge in Chambers. The Judge
has the discretion to up hold the Commissioners' finding,
modify it or reverse it completely.
3XEOLFUHVSRQVHWRWKH$FW
In general, the FCA and its enforcement body, the FTC
has received a positive reception from the Jamaican public. The FTC is seen as a pro-active agency with a reputation for effectiveness and efficiency. This is due in part to
the provisions of the Act, which permit the agency to seek
stiff penalties for failure to co-operate with the Commission. Although the Commission's focus is the nation at
large, that all-encompassing term can be divided into
three categories: the business community, consumers and
the professional sector.
7KHEXVLQHVVFRPPXQLW\
The Commission's experience with this sector has been
mixed. It is human nature to resist change. However, the
Commission has been successful in implementing its
policies where it has been able to show that its recommendations are beneficial to the business, as well as the
consumer.
The primary issue that surfaces with regard to this sector is the matter of disclosure, which is addressed by section 37 of the Act which speaks to Misleading Advertising. Businesses have been required to provide more
complete disclosure regarding their products and services, methods of payment, etc. to enable the consumer to
make informed decisions.
The business benefits as the rights and obligations of
its consumers are clearly outlined prior to the completion
of the transaction and, therefore, the consumer cannot
claim ignorance.
&RQVXPHUV
Initially, the Commission's focus was that of a consumer protector. This proved to be useful as it helped the
Commission to earn public support and effectively communicated to the average person those aspects of this new
law which would directly impact their day-to-day existence. The Commission was seen as the saviour for every
beleaguered consumer who had purchased a malfunctioning appliance or was duped by slick advertising.
More recently, the F17C has shifted its focus to some
extent so as to deal with the more sophisticated issues of
competition law. The agency now primarily addresses the
issues, which affect a significant cross-section of the community. If the complaint is particularly egregious and/or
raises issues for the public at large or if the complaints received reveal a pattern of anti-competitive conduct, then
the will consider intervention.
It is not the case however, that consumers have been
left to fend for themselves. The government recognizes
the need for an agency which focuses on the right of the
individual and has therefore set up the Consumer Affairs
Commission (CAC) with significant funding. That body
handles individual disputes and is not bounded by the
strictures of any particular statute.
7KHSURIHVVLRQDOVHFWRU
The legal community has, in some instances, been a
particularly harsh critic. However, the Commission is undaunted and works diligently in an effort to educate the
Bar as to our role and function. The Commission accepts
that the adversarial stance of the lawyers may simply be
vigorous representation of their clients, as well as a defensive reaction to an extremely pro-active statutory body.
Additionally, research has shown that there is indeed a
difference between the common law principles and definitions and those of competition law, in that competition
law has its own unique nuances and concepts, and these
differences have not been readily accepted by the legal
community.
The Commission believes that its on-going educational
programme will go a far way in helping to woo this reluctant group.
7KH UHODWLRQVKLS EHWZHHQ WKH )7& DQG RWKHU
VWDWXWRU\ DJHQFLHV
Section 54 of the FCA states, LQWHUDOLD, that “this Act
binds the Crown”. However the Commission has interpreted this to mean that its power does not extend to government when the latter acts in its executive capacity.
Conversely, the Commission holds the view that government is regulated to the extent that it engages in trade.
For the most part, the Commission has enjoyed amicable working relationships with other statutory organisations. However, there have been instances where some
regulatory bodies resist the Commission's intervention as
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
it is viewed as an encroachment on their turf. This will be
more fully discussed, infra.
to the FTC so that the Commission may advise on competition implications that may arise.
By way of example, however, the following have been
found to be co-operative:
-DPDLFD3XEOLF6HUYLFH&RPSDQ\/LPLWHG-36&R
2IILFHRI8WLOLW\5HJXODWLRQV285
The staff of the Commission involved itself in extensive discussions with the OUR regarding formulating
their draft legislation. Specifically, the OUR sought the
FTC’s input so as to ensure that the regulatory framework
of the proposed legislation takes into account competition
policy and objectives.n
The staff has conducted intensive reviews of the complaints received against this state monopoly. These complaints relate to pricing, meter reading, and selective tendering of contracts. 1 n some instances, it has been found
that the FTC does not have jurisdiction, and thus the matters are referred to the Ombudsman for Public Utilities.
However this does not alter the fact that the JPSCo. does
engage in trade and is therefore subject to the FTC's jurisdiction.
&XVWRPV([FLVH'HSDUWPHQt
-DPDLFD%XUHDXRI6WDQGDUGV-%6
The staff of the Commission, along with senior representatives of the Customs Department, the Ministry of Finance, the Revenue Protection Division and the Customs
Brokers' Association of Jamaica, discussed the mandatory
use of the services of customs brokers by consumers for
goods valued at US$ 1,000 and upwards. The staff of the
FTC, after a thorough consideration of the competition
implications, and following discussions with the above
organisations, was able to provide the relevant governmental body with an advisory position and recommendations. In sum, the staff recommended that the threshold be
raised US$ 3,000, so that these would be less hardship for
the consumer while protecting the government's right to
collect revenue and protect its borders. This body has
agreed to take the FTC’s position into account, (notwithstanding its autonomy to regulate the area of revenue collection), when drafting legislation for the aforementioned
area.
1DWLRQDO:DWHU&RPPLVVLRQ1:&)
The Commission investigated this state monopoly with
a view to determining whether the company was abusing
its dominant position by passing off its inefficiencies to
the consumers in the form of increased rates. After prolonged studies and economic analysis, the staff found
evidence of abuse. In a meeting wherein the Commission’s staff discussed its findings, the company agreed to
co-operate with the staff whereby the Commission would
continue to monitor the company and the company
would, in turn, provide the Commission with ongoing status reports regarding the implementation and progress of
certain programmes in the areas of weaknesses that had
been identified.
3RUW$LUSRUW$XWKRULW\RI-DPDLFD
The staff of the Commission has held continuing discussions with authorities for the air and sea ports of the island. Specifically, the staff has informed these authorities
of the competition implications which impact on the current deregulation exercise being conducted by both entities. The Airports Authority has actively sought the FTC's
input in this area. With respect to the sea ports, the Commission's staff has consulted with the relevant Ministry
and the Port Authority, with a view to dealing with the issue of ensuring equal access to the ports for all players in
the tourism transport market. This Authority has now referred the body responsible for this deregulation exercise
A deregulated economy has resulted in a wider variety
of items offered for sale in the market. These items were
previously not available for purchase by consumers.
However, arising from this situation is an increase in the
number of substandard goods entering the Jamaican marketplace, since some importers choose low unit price over
acceptable quality. The above-mentioned scenario has
brought the FTC and the JBS into a very close working relationship. In fact, the FTC's mandate of consumer protection and the JBS's responsibility of ensuring that goods
offered for sale comply with basic international standards
appear to converge at this point. The FTC has, from time
to time, called upon the expertise of the JBS in areas
where the Commission requires a determination based on
technical analysis and assessment. One common area of
co-operation is that of the JBS performing standards testing in the laboratory and giving its opinion and/or report
in matters relating to electronic appliances.
The co-operation between both agencies has also seen
the passing of information from one agency to the other.
For example, the FTC, on the basis of numerous complaints received concerning a particular product, may request the intervention of the JBS which will then undertake an empirical investigation and make a decision
regarding that item in question. Very often, the decision
results in the banning of that particular product.
The JBS, for its part, informs the FTC of any discovery
of substandard products which have been imported and
are being offered for sale in the market. The FTC then
may recommend that individuals who have been injured
be offered some form of redress.
Additionally, other statutory departments and agencies, such as the Broadcasting Commission and the Ministry of Construction, have sought the FTC's assistance regarding their tendering process and practices in an effort
to ensure that the laws regarding competition are not
breached.
It can therefore be said, that in exercising its mandate
to regulate competition in a new liberalized economy and
to ensure the observance of the provisions of the FCA, the
Commission has had to build close relationships with other statutory agencies, the actions of which impact on the
operation of the free market economy. In many instances,
those agencies are now actively seeking the FTC's input
in shaping their own policy.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
*HQHUDO/HJDO&RXQFLOY)DLU7UDGLQJ&RPPLVVLRQ
As noted initially, the Commission has met with resistance from some statutory bodies. Where such conflict has
not been resolved, both statutory entities have guarded
their turf jealously and in one instance, the issue of jurisdiction has been adjudicated. Specifically, there is the
case of the *HQHUDO /HJDO &RXQFLO v WKH )DLU 7UDGLQJ
&RPPLVVLRQ
)DFWRUVZKLFKKDYHFRQWULEXWHGWRWKHGHYHORSPHQWRI
WKH)7&
,QWHUDFWLRQ ZLWK LQWHUQDWLRQDO FRXQWHUSDUWVGRQRU
DJHQFLHV
The FTC has been the beneficiary of a significant
amount of assistance, primarily from the United States
Agency for International Development (USAID) and the
British High Commission, among others.
The General Legal Council (GLC) established under
the Legal Profession Act (LPA) sought to determine
whether the FTC could exercise its jurisdiction over that
body. The Supreme Court held that the GLC is not amenable or subject to the jurisdiction of the FTC. (Please see
discussion, infra, of this decision).
By virtue of a Memorandum of Understanding between the Government of Jamaica and the USAID, the
USAID has provided funds to facilitate public education,
technical assistance, computer administration and network linkages and the procurement of reference materials.
It is the Commission’s position that the Court ousted
the jurisdiction of the FTC, because there was specific
legislation which governed particular practices.
The FTC has received technical assistance from the
USAID in the form of internship programmes and missions organized in conjunction with the US Department of
Justice (DOJ) and the United States Federal Trade Commission (USFTC). Through the internships, the FW staff
has been exposed to the procedures and investigational
techniques employed by these agencies. Through the
short-term missions, US attorneys, economists and computer specialists provide consultancy services, conduct
in-house training of FTC staff and also participate in public education seminars. Additionally, the internships and
missions have served to cement working relationships between personnel of the FTC, DOJ and the UK's Office of
Fair Trading, allowing the FTC to continue to benefit
from the expertise of agency staff of the listed bodies,
even after the participants return to their countries of
origin.
With respect to other professional bodies, such as the
medical profession etc, the Commission has taken the position that generally it can exercise concurrent jurisdiction. However, it has no right to intervene where there is
particular legislation that requires these bodies to act in a
certain manner.
The Commission is currently seeking to amend the
FCA, so that all professional services fall within its jurisdiction, notwithstanding the existence of specific legislation. However, the Commission does not intend to disturb
any profession’s authority to regulate standards of competence.
-DPDLFD6WRFN([FKDQJHY)DLU7UDGLQJ&RPPLVVLRQ
In another matter currently before the Courts, the -D
PDLFD6WRFN([FKDQJHYWKH)DLU7UDGLQJ&RPPLVVLRQ
the JSE is seeking to have determined the question of jurisdiction. The JSE believes it should only be regulated by
the 6HFXULWLHV &RPPLVVLRQ(SC), established under the
6HFXULWLHV$FW6$ in 1993. For its part, the FTC claims
concurrent jurisdiction with the SC (Please see further
details, infra).
6XPPDU\
The above discussion raises core issues as to the extent
to which the FTC can exercise jurisdiction vis-à-vis another regulatory body. In other jurisdictions, a competition tribunal may have concurrent jurisdiction with another regulatory body. Ultimately it is a matter of statutory
interpretation as to whether there is room for both bodies
to play a regulatory role, or whether only one regulatory
agency has jurisdiction.
One possible solution is that the problem should be addressed by Parliament. In other words, Parliament in enacting legislation, should specifically state whether or not
a particular area should be exempt from competition legislation, thus avoiding ambiguities as to the scope of the
Commission's jurisdiction.
Specifically with regard to the British High Commission, it has provided technical assistance in the form of
funding internships for FTC staff to visit, observe and
learn from their British counterparts at the Office of Fair
Trading (OFT) and the Monopolies and Mergers Commission (MMC). The British High Commission has also
funded the Commission's Executive Director's participation in an international seminar on Competition Law in
London.
The FTC staff’s initial problem concerned die acquisition of reference materials to assist with investigations
and to inform it on the status of competition law in other
states. However, that problem has been addressed through
the USAID which has facilitated the acquisition of the
Lexis/Nexis system and the Internet in May 1996. The installation of these computer linkages has gone a far way
towards allowing the FTC staff access to materials to support investigations and in some cases, litigation. USAID
has provided the initial subscription fees for these services. Hopefully, by the time the funding has expired, the
Commission would have amassed a body of information
sufficient to aid its work in the area of competition law
and practices.
3XEOLFHGXFDWLRQSURJUDPPH
The success of any competition legislation is intricately linked to the provision of adequate information to promote an understanding of such legislation. Public educa-
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
tion has therefore, become the vehicle by which such
information is disseminated.
The FTC has, since its inception, embarked on an aggressive education programme aimed at inflorining both
businesses and consumers of the provisions of the law and
how they may be affected by same.
In order to effectively propagate the information produced by the FTC, the Commission has utilized a variety
of channels to achieve this objective. To this end, the FTC
has promulgated press releases, advisory opinions and
policy papers on several industries operating within the
Jamaican marketplace. The automobile, insurance, banking, real estate industries are among those reviewed. The
Commission also produces an annual report outlining the
work carried out by the Commission for that year. These
reports are sent to a number of institutions. Copies are
also readily available at the offices of the Commission.
The FTC has also utilized the electronic media to transmit its education programme by appearing on various talk
shows and granting interviews. Not to be outdone are
presentations made at various types of gatherings, for example, at corporate meetings, citizens’ associations, seminars, exhibitions, and lectures at educational institutions.
The on-going education programme of the Commission has seen a marked change in the responses and attitude of target groups and indeed, the general psyche of the
Jamaican marketplace.
*HQHUDODFKLHYHPHQWVRIWKH)7&
The Commission’s achievements have undoubtedly
emanated from its active and continuing educational programme, its resolve to enforce the law, its willingness to
provide guidance in terms or how businesses should operate within a free market system, and its facilitation of redress for the injured parties.
Since its inception, the FTC, as the regulator of business practices and conduct within the free market, has created a more sensitized and enquiring business community. This is evidenced by the numerous opinions and
advice sought by businesses operating in the Jamaican
marketplace.
The F.TC has been particularly successful in educating
businesses that the provision of material information concerning purchases is vital to consumer’s ultimate purchasing decision. As a result of this, businesses have taken the
time to convey information by way of clearly worded
signs placed at conspicuous points in stores as well as on
their sales receipt.
The consumers have also become more vigilant and are
at this point demanding information relevant to purchases, refusing to purchase from stores where they are riot
adequately informed, and notifying the FX if they believe
the practices of these entities run afoul of the law.
Perhaps the major accomplishment of the FTC lies in
the area of complaint resolution by way of settlements or
through legal proceedings. Statistics for the period September 1993 to December 1995 indicate that of a total of
one thousand five hundred and forty-seven (1,547) com-
plaints, one thousand two hundred and thirty (1,230) have
been resolved. This represents a resolution of 80% of all
complaints lodged for that period. Some of the more celebrated cases are FTC vs Air Jamaica, FTC vs Caribbean
Cement Company, FTC vs Telecommunications of Jamaica, FTC vs John Crook. The details of these cases
among other will be cited in the section titled “Summary
of Complaints brought before the FTC”.
The FTC has also forged a successful working relationship with a variety or interest groups. Of note is the Commission's continued dialogue with Courts Jamaica Limited (the island's largest retailer in the furniture and
appliances) and the Petroleum Marketing Companies.
The relationships have in fact contributed ultimately to a
more healthy business environment through constant dialogue and co-operation.
A similar relationship has been forged with consumer
groups. The Commission provides assistance by way of
advice, policy papers and guidelines with regard to matters complained of and those likely to be complained of.
This liaison has seen an increase in consumer vigilance
and a deepening of the recognition of their rights and responsibilities and the recourse available to them under the
FCA.
6XPPDU\ RI FDVHV EURXJKW EHIRUH WKH )DLU 7UDGLQJ
&RPPLVVLRQ
7HOHFRPPXQLFDWLRQVRI-DPDLFD/LPLWHG72-
Following negotiations between the TOJ and the FTC,
an agreement was reached whereby TOJ's residential customers were allowed to connect certain compatible equipment to the TOJ network for a reasonable price. Prior to
the FTC's intervention, this had not been the case. The
consumer was required to purchase all equipment from
TOJ and if TOJ did not have the item in stock thereby necessitating its purchasing elsewhere, the customer was
still required to pay a rental charge to TOJ The FTC took
the position that TOJ’s conduct constituted an abuse of
dominant position in the market for telecommunication
services. TOJ agreed to interconnection without admitting liability.
&DULEEHDQ&HPHQW&RPSDQ\&&&
A complaint was made against CCC charging that its
practice of constantly raising prices was an abuse of its
dominant position. The Commission retained an outside
consultant to examine the company's business practices
in order to ascertain whether or not the price increases
resulted from inefficiency or were otherwise justifiable.
The Consultant opined that there was an under-utilization of assets and that the company was not taking advantage of modern technology available in the marketplace
which could substantially increase its efficiency, He further advised that major capital expenditure would he required to effectuate improved productivity which would
hopefully lower cost in the long run. The upshot would be
a lower price to the consumer.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
The company did not completely agree with the consultant’s findings but overall was amenable to reviewing
its operations. Given that undertaking, the Commission
decided to suspend its investigation but would continue to
monitor the company’s operations. So far, the company
has reduced its prices twice in the last six months.
-DPDLFD6WRFN([FKDQJH-6(
Subsequent to the FTC’s filing a complaint against the
JSE for abuse of dominance, the JSE filed its own suit
claiming, LQWHUDOLD, the Commission lacked jurisdiction.
As noted earlier, it is the JSE’s contention that it should
only be regulated by the Securities Commission. For its
part, the FUC claims concurrent jurisdiction with the SC.
The trial commenced June 3, 1996. It has been adjourned
and is expected to reconvene later this year (1996).
1DWLRQDO:DWHU&RPPLVVLRQ
As observed earlier, the FTC’s staff investigated this
state corporation seeking to determine whether the company was abusing its dominant position by passing on its
inefficiencies to the consumers in the form of’ increased
rates. Evidence of abuse was found by the staff.
Eventually, the staff and the company arrived at an
Agreement, wherein the company agreed to tile continuous monitoring of the company. Additionally, the Company assumed the duty of providing the Commission with
quarterly reports regarding the implementation and
progress of certain programmes in the many areas of
weakness that were identified, namely –
—Meter replacement,
—Leak detection and repair,
—Revenue enhancement,
bers to behave in a more individualistic fashion and
thereby stimulate competition within the industry.
3HWUROHXP&RUSRUDWLRQRI-DPDLFD
This state monopoly was investigated because it was
alleged that the company was engaged in unfair pricing.
The Commission's investigation revealed, however, that
although the company was indeed a monopoly (it being
the only oil refinery in the country) it was not dominant as
that term is defined by the FCA, given that potential competition from existing marketing companies constrains its
conduct. In other words, the present company is mindful
that if prices are raised beyond a certain level, others will
enter the market. That forces them to keep their own prices competitive.
*HQHUDO/HJDO&RXQFLOY)DLU7UDGLQJ&RPPLVVLRQ
7KH*HQHUDO/HJDO&RXQFLOY)DLU7UDGLQJ&RPPLV
VLRQ case is one of the matters which has been adjudicated
in the Supreme Court since the enactment of the FCA, and
has already been discussed, supra. The facts, however, are
now more fully set forth.
In July 1995, the GLC took the FUC to court. It wanted
the court to determine whether or not the LPA has been
repealed by the FCA. The court declared that in performing its statutory functions and duties under the LPA, the
GLC is not amenable or subject to the jurisdiction of the
FTC established under the FCA. Additionally, that the
Legal Profession (Canons of Professional Ethics) Rules,
being subsidiary legislation and/or statutory rules made
under the LPA are riot governed by tile FCA. The court
also declared that the provisions of the LPA and the Legal
Profession (Canons of Professional Ethics) Rules made
thereunder are not repealed, amended, nor modified by
the provisions of the later enacted, FCA.
As noted above, an amendment of the FCA is being
sought so that all professional services fall for regulation.
—Collections,
—Operational strategies: including the billing cycle
and standpipes,
—Preventative maintenance and plant improvement,
and
—Cost reduction strategies
7KHEDNLQJLQGXVWU\
The Commission initiated an investigation, sua sponte,
to determine whether the industry members were engaged
in price fixing. While investigations revealed no concrete
evidence of concerted action, it was somewhat disturbing
to note that prices tended to be uniform. One explanation
is our country's history. In other words, against the backdrop of Jamaica having been subject to a centrally
planned economy for most of its history, most manufacturers set their prices by simply taking the prices that the
industry leaders charge and simply follow suit. This phenomenon is known as price leadership. The Commission
determined that periodic review of this industry is necessary because although there is no direct evidence of conspiracy, the Commission would like to encourage mem-
7KH%DQNLQJ,QGXVWU\
The FTC arrived at an agreement with the Bankers Association of Jamaica. This agreement was brokered as a
result of allegations that documents often signed by clients are not written in “reader-friendly language” so that
the average consumer does not understand what he or she
has signed. The agreement sought to cover the areas of:
&ODULW\LQEDQNLQJGRFXPHQWV
It was agreed that a fact sheet in layman's language
would be attached to the face sheet of all loan documents for individual consumers. The fact sheet
would contain information that the average person
would consider material. The sheet would detail, at
the very least, the effective interest rate, whether or
not there are prepayment penalties and the total
amount of the loan.
7KHSRVWLQJRIWKHH[FKDQJHUDWH
The banks would indicate whether or not these rates
were opening rates only. In other words, the con-
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
sumer should be put on notice if the rate stated could
vary throughout the day. If that indication is not given, the consumer is entitled to assume that the rate
given is the set rate and should be given foreign exchange at that rate.
7KHDGYHUWLVLQJRILQWHUHVWUDWHV
Where “add-on” rates are used, they will be designated as such. However, it was generally agreed that
it would be more useful to state the effective rate of
interest when advertising as the add-on rate is deceptively lower. This will minimize confusion and the
average consumer will be better able to compare
rates among banks.
The MAJ has agreed, as part of the settlement with the
FTC’s staff', that it would institute a 90-day period for the
procession of applications for recognition and, should an
application be denied, that denial may be appealed to a
three-person panel who are unconnected to the media.
Additionally, there is also the possibility of provisional
recognition where an agency, new to the marketplace,
may nonetheless be afforded the legal benefits of a recognized agency. Provisional recognition automatically expires at the end of one (1) year, at which point the agency
may apply for full recognition.
-RKQ&URRN/LPLWHG
The JBA and the FTC plan to continue dialogue as
there are other issues which need to be addressed. These
issues involve the use of panels of professionals and tied
arrangements which are allegedly the practice of most
banks. The FTC and the JBA will notify the public as to
the outcome of its discussions on those matters.
Acting on complaints, which in sum alleged that John
Crook sold 1989 Ladas to the public as 1993 vehicles, and
1993 Subaru Justys as 1994 models, the FTC was able to
broker a settlement in favour of the complainants. The
settlement package arrived at saw the company paying
out approximately four million dollars ($4,000,000.00) to
individual complainants who had purchased the automobiles in question.
0HGLD$VVRFLDWLRQRI-DPDLFD
$LU-DPDLFD/LPLWHG
The staff of the FTC and the Media Association of Jamaica have reached a settlement concerning that Association's Recognition Agreement. Prior to the advent of the
FCA, media houses by means of the so-called Recognition Agreement, would pay a fixed commission and
extend credit to only “recognized” agents.
Several individuals complained to the FTC regarding
what they alleged as Air Jamaica's nondisclosure of additional charges for its “Love-A-Fare” package. A particular fare was advertised, yet when the consumer arrived to
purchase their ticket, they were then made aware of additional charges. The Commission viewed that practice as
misleading advertising. In the settlement, arrived at with
the company, it was agreed that passengers who could
prove that they traveled within the particular period (February 14—March 10, 1995) would be given special upgrades. The offer remained open until July 31, 1996.
To be “recognized” an agent had to apply to the MAJ
and satisfy it as to certain billing and other structural capabilities. Having been duly satisfied, the MAJ would
then pay a fixed commission of 18% to that agency in addition to extending it a credit period for advertisements
place in the various media. Should the agency fail to pay
its bills timely to even one media house, all media houses
would deny that agency credit.
It was the view of the staff of the FTC that the FCA
made those specific portions of the agreement illegal. The
getting-together of the media houses to fix the amount of
the commission, in the view of the staff, constituted both
a conspiracy to restrain competition and price-fixing. Additionally, it was felt that media houses which act in concert against an agency are behaving in a cartel-like fashion which also constituted a conspiracy against
competition and thus disfavoured in a free market system.
The unequal treatment of the unrecognized agents also
invited scrutiny of the staff, for while the MAJ can certainly put in place reasonable standards for recognition, it
is anti-competitive to penalize media houses who choose
to extend credit and pay commissions to those agents who
happen not to meet those standards. Commercial entities
must not be deprived of their ability to engage in independent decisions-making vis-à-vis trading partners.
In light of the effect of the staff s views, the MAJ entered into negotiations with a view to arriving at a form of
Agreement which would not offend the terms of the FCA.
The parties developed a Recognition Agreement which
conforms to the terms and spirit of the FCA.
,VVXHV*HQHUDOO\3HFXOLDU7R$'HYHORSLQJ(FRQRP\
*HQHUDOLQIRUPDWLRQ
A newly formed competition agency should develop a
close relationship with other domestic and international
bodies which can provide assistance with the gathering of
necessary information. As discussed, supra, staff participation in the various internship and externship programmes offered by international competition agencies
may facilitate (lie development of greater technical expertise in this specialized field. It will also, expand basic information concerning particular industries.
'UDIWLQJWKHOHJLVODWLRQ
The drafters of the Jamaican FCA extracted portions of
existing legislation from Commonwealth jurisdictions,
primarily New Zealand, Australia and the European Union. This was necessary as it allowed thein to consider a
variety of styles and approaches to the enforcement of
competition law. The Jamaican experience however, has
shown that is can be dangerous to adopt legislation on a
piece-meal basis. The section of the Act which prohibits
a company's abuse of its dominant position in the marketplace, for example, suffers from certain philosophical
inconsistencies which have come about because that par-
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
ticular section is an amalgamation of sections of the New
Zealand Commerce Act, the Article 86 of the European
Union’s Treaty of Rome.
The United States of America has been engaged in
competition law since the late nineteenth century and has
earned the reputation of being an expert in this field. The
Jamaican FTC has, quite understandably, used the expertise, policies and internal procedures of the United States,
in formulating its own. Notwithstanding the shared common law jurisprudence of the Commonwealth and
American jurisdictions, it may be difficult to reconcile the
written legislation of Commonwealth jurisdictions with
the American policy perspective. There is a basic difference in U.S. administrative law and that of Commonwealth countries.
Additionally, in light of the FTC’s approach in playing
different roles (to be discussed in more detail below), the
drafters would be well advised to define carefully the
roles of the Commissioners vis-à-vis the staff, and to ensure the consistent use of the terminology throughout
their competition legislation. This will facilitate the efficient application of the Act.
One should also consider the role that Parliament
wants competition law to play in one's economy. That
cannot be decided without considering the state of a country's economic development and its plans for future
growth. Perhaps one of the most important questions that
should be asked and answered before the statute is actually drafted, is whether the legislation should form the basis
of the country's economic constitution? This will force
Parliament and the public to give due consideration for
the principles and policies which are intended to underpin
the legislation itself. For this very reason, it is essential to
properly document each stage of the Parliamentary and
drafting process. This will provide generations to come
with information on the genesis of the law and its intended application.
2SHUDWLQJSURFHGXUHVRIWKH)7&
The Commission was established to administer and enforce the provisions of the FCA. To enable the exercise of
this function, the FX has been empowered by section 5 (1)
of the FCA, to “carry out at its own initiative or at the request of any
person such investigations in relations to the conduct
of business in Jamaica as will enable it to determine
whether any enterprise is engaging in practices in contravention of this Act….”, LQWHUDOLD
In carrying out its statutory functions, the Commission
as a law enforcement agency, performs the multiple, but
distinct roles of complainant, investigator and adjudicator, thus wearing many hats, so to speak. Therefore the
three separate and seemingly conflicting functions of investigation, prosecution and decision-making, are fused
together in one entity, with combined functions requiring
separate procedures, thereby creating what one Court has
described as statutory schizophrenia.1
1
Fisher & Paykel Ltd. v. Commerce Commission & Ors (1990) 3
NZBLC, 101,660, wherein it was noted that amendments to New Zealand’s competition legislation led to the combining of investigative and
adjudicative functions.
While this may appear to be inherently inconsistent,
other jurisdictions with similar competition tribunals have
found that this does not violate the principles of natural
justice.2
While it is also this Commission’s view that this fusion
of multiple roles does not impair the principles of fairness, it is aware of the possible perceptions of injustice
and has put in place procedural safeguards. Some of these
are outlined below:
1.
On those occasions when the Commissioners act
in a judicial capacity the Executive Director never
participates as a Commissioner, although the Executive Director is identified as an “ex officio
Commissioner” in the FCA; and
2.
Once a complaint has been laid before the Commissioners, there can be no ex parte communications with them by the staff. With respect to items
1 & 2, it should be noted that under section 52 of
the FCA, the FTC may, with the approval of the
Minister, make Regulations prescribing the procedure to be followed in carrying out the provisions
of the Act.
To date, the FTC has not promulgated regulations.
However, procedural guidelines have been formulated
which are comprehensive in scope, and exhibits the observance of the principles of natural justice. Briefly, these
procedures cover the following areas: the Examination of
Witnesses, the Production of Documents, Applications
for Authorization, Commencement of Proceedings where
the Commission is authorized to make a Finding, Prehearing Procedures, and the Procedures for Appeal of the
Staff Findings.
(FRQRPLFWLSV
Although competition agencies are primarily concerned with the enforcement of competition legislation,
this task is not exclusively legal in nature. As stated hereinabove, the role of economics is of supreme importance.
Thus careful consideration should he given to the needs of
both departments.
It is also advisable that economic guidelines be formulated at the outset as these guidelines would create a
standard procedure for the assessment of various breaches
under the Act. The Jamaican FTC has formulated such
guidelines and those are available to all who wish them.
&RQFOXVLRQ
Small island economies face certain realities which
cannot be ignored. Creative solutions, therefore, must be
found so that, in the long run, the inherent harshness of
antitrust philosophy is not a legislative cross to be borne
and despised, but a challenge to which they can rise and
2
FTC v. Cinderella Carrer & Finishing Schools, 404 F2d 1308
(D.C. Cir. 1968, wherein it was held that for the Federal Trade Commission to consider recommendation of subordinates, issue a complaint
and a press release and later to decide the case, does not violated due
process; See too, Sharpe v. The Jamaica Racing Commission (1974) 12
JLR, 1319, discussing how bodies that serve combined functions do not
violate natural justice principles in so doing.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
eventually an aid in helping them to take their place
alongside their global counterparts.
ing and any ambiguities should be resolved in favour of
the consumer.
Small island economies which have a history of being
state-controlled, have to be educated as to the differences
which obtain in a free market economy. In is therefore important to educated the public at large and also focus on
certain groupings within the economy so that they may
know how to adjust their conduct accordingly.
It is important the antitrust agency be aggressive at the
outset. The market place must be made aware of its presence. The legislation therefore should allow the agency to
set on its own initiative and not simply react to complaints.
Disclosure is a key element in a liberalized regime.
Given the selective unsophisticated nature of consumers
in developing countries, businesses used in their advertis-
Internationally, developed countries should willing to
exercise patience. Time must be given for the changing of
the psyche of the marketplace.
(OLPLQDWLRQRIWUDGHPHDVXUHVLQDFXVWRPVXQLRQDQG
WKHLUUHOHYDQFHWRUHJLRQDOLQWHJUDWLRQ
%\-DPHV0DWKLV
Trade Law Program Coordinator
Department of International Law
University of Amsterdam
,QWURGXFWLRQ
goods for substantially all of the trade. Some type of common commercial policy is designated to operate the decision-making aspects of this uniform tariff and for both import and export measures. This may not require an
independent institution, but whether it is formal or informal, some assurance of uniformity in the tariffs application by each member state is required in order to maintain
the external legal structure of the entity as a separate customs territory.
The selection of a legal form for regional trade groupings will be made on the basis of a number of factors, but
one major factors would be the degree of unified external
representation the group wishes to achieve in international trade. Members seeking to speak together as a single
territory will consider a customs union formation rather
than a free-trade area where each member retains its individual commercial policies as to third party goods. For
customs union members, although a leading motive for
formation may be external or representational, many of
the consequences of making this choice are decidedly LQ
WHUQDO to the grouping, especially as to those aspects relating to how goods are circulated within a completed territory. For customs unions, the primary internal
consideration is to establish the legal basis for free circulation for goods whereby third party goods admitted to the
union circulate on the same basis as member state goods.
This requires the condition of uniformity in the external
tariff. Upon this development, deviations in treatment for
imports are eliminated and the need to establish the country origin of goods in LQWUDunion trade is no longer necessary in order to confer the preference for local goods.
There is a strong link between the ability to establish
and maintain a uniform external tariff and the ability for
the union to provide for the internal free circulation of
goods, as the first is a precondition to the second. As for
the case of a single national territory, once duties are paid
and compliance with other customs formalities is completed, goods are then admitted for sale and will circulate
within the territory on the identical basis as those goods
produced by a member. Under this condition, there is no
need to assess the origin of goods as they across internal
national borders, since this all applicable trade measures
have already been assessed by the union on the point of
initial entry. Although internal controls for inspection and
certification may persist where members have not harmonised health and safety requirements, these operations,
while requiring frontier controls, are not trade policy instruments and do not require certificates of origin. Inspections are made on third-party goods in the same measure
as they are performed on member state goods.
The establishment of external uniformity for trade
policy and the provision for free internal circulation also
suggests that member states should forego the legal ability to apply trade policy instruments to the goods of other
member states, especially contingent trade measures such
as safeguards and anti-dumping. This is effected by establishing a prohibition against the use of such measures. At
this point a regional competition policy becomes relevant
as it is able to provide an alternative remedy for antidumping. The appropriate competition policy to consider
therefore is that policy which can insure that private restraints will not frustrate the re-exportation of dumped
goods between the member states. It follows that a core
competition policy element in the determination to form a
customs union is a policy able to address vertical
restraints.
,
In order to summarise, consider the case where uniformity of entry conditions is not attained by the union.
Where the import treatment for third party goods varies
from one entry point to another and for whatever reason,
then free internal circulation for those goods will also fail.
The member state imposing the higher entry requirement
will seek to impose internal customs control as necessary
to avoid trade deflection as third party goods are routed
via the lower tariff member state. In re-establishing national commercial policy, origin verification will also be
required to be re-established, since some goods of third
party origin will be assessed for the adjusting measure and
member state goods will not.
/HJDOIRUPFXVWRPVXQLRQ
,,
Since a (completed) customs union is also a customs
territory, member states should forego their individual external commercial policies to whatever extent is necessary to present a common external tariff as to third-party
7KHUHTXLUHPHQWWRHOLPLQDWHLQWHUQDOPHDVXUHV
Once free circulation is committed to be achieved, the
retention by a member of the power to impose antidump
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
ing measures on the goods of another also appears inconsistent with the concept of a single territory. If internal
trade measures are permitted to be imposed by member
states, then (non preferential) origin rules must also be recalled LQWHUQDOO\ in order to determine which goods shall
be subject to dumping duties and which goods shall not.
Therefore, just as in the case where disparities in external
application of the tariff will result in the imposition of national internal measures to avoid trade deflection, national
internal trade measures imposed between members will
produce the similar result. In both cases free internal circulation will fail to be achieved as an aspect of the customs union formation. As a practical matter, this result is
also paradoxical where goods produced within the territory can be subjected to treatment that is worse than that
to be applied to third-party goods.
context is that which provides a legal redress for vertical
restraints imposed in the member state of origin.
Based upon these considerations, the choice of forming a customs union should also be accompanied by a prohibition of internal antidumping measures, to be made
effective not later than the end of the transition period.
3ROLF\FRQVLGHUDWLRQV
,,,
&RPSHWLWLRQ SROLF\ WR JLYH HIIHFW WR WKH
SURKLELWLRQ
Once member states are pledged to the elimination of
internal measures, it is then possible, if not necessary, to
contemplate an appropriate competition policy response
at a regional level which will permit this prohibition to securely function in practice. In this sense, it can be argued
that the appropriate regional competition policy is one
which will support the prohibition made against trade
measures, i.e., a decision to prohibit anti-dumping internally should act to define the minimum competition policy required to validate a customs union formation. This is
distinct from the policy options presented in a free-trade
area where member states choose to retain the power to
apply trade measures in regard to the goods of other member states.
Although other aspects of competition policy should
also be considered in the equation of customs territory
formation, the essential formulation of competition policy
in this regional context is to provide for the legal means to
guarantee that traders in the territory will be secured in
their ability to re-export any dumped goods back to the
member state of origin. This is understood to provide a
market-driven or self-corrective mechanism which will
act to undermine the benefits anticipated from dumping,
at least to the extent that the price difference between
markets does not exceed the cost of re-transport, administrative costs, plus profit. Where it is provided, this guarantee of re-exportation will eliminate market strategies
based upon price discriminatory predatory behaviour.
,9
&RPSHWLWLRQSROLF\HOHPHQWV
If we understand that territory formation has provided
for the elimination of public barriers in the form of tariffs
and quotas, traders will then only be frustrated in re-exportation by the use of private restraints which act to prevent goods from entering the distribution channels of the
home market. Thus, it appears that the competition policy
element essential to customs union completion in this
The elements which can be designated to this policy
include the following:
— A definition of legal regional territory jurisdiction
which is directed to the elimination of distortion to
trade EHWZHHQ the member states;
— A basis for complaint and prompt redress on behalf
of firms and individuals seeking to re-export; and,
-— A guarantee of uniformity for the interpretation of
the competition policy principle as it is to be applied
throughout the customs territory.
As demonstrated by the EC experience, these elements
can be provided in a centralised agency which functions
independently at the regional level. For the EC, this
means a requirement for undertakings to notify vertical
restraints to a single regional agency (European Commission, DG-IV), and then by providing that exemptions permitting pro-competitive restraints can only be granted by
this central regional authority. Undertakings may complain directly to the Commission, but may also direct
complaints to member state authorities, which are encouraged to make determinations and engage in enforcement.
However, in the EC system a member state authority cannot grant an exemption. Certain de-centralised aspects are
also provided. By Court of Justice rulings, the regional
prohibitions for anti-competitive practices are given direct effect in the Community legal order. Undertakings
may initiate actions against other undertakings in the national courts of the member states national courts which
are bound to apply Community law. The Treaty provides
a procedure for preliminary opinions by these national
courts to the EC Court of Justice. Points of law are interpreted by the regional court, published, and then applied
by all national courts as applicable law.
Although the existence of member state authorities are
now understood to be a vital aspect of making this policy
effective, the existence of national authorities is not a legal pre-requisite to the implementation of a regional competition policy. Likewise, although the EC relies upon a
centralised agency at the centre of the policy, it cannot be
concluded that the provision of such an agency is a also
pre-requisite to giving a treaty prohibition legal effect.
In the case of COMESA, the existing prohibition
against restrictive business practices which distort trade
between the member states should suffice as a legal basis
to enunciate a regional competition policy for these purposes. The national courts of the member states can act as
receivers of complaints and then apply the regional prohibitions to particular cases. A preliminary opinion procedure or appeal procedure can guarantee uniformity of
interpretation by the COMESA regional court. The
COMESA secretariat can play a supporting administrative and research role for the Court, and can be responsible for effecting the policy by education efforts throughout the market. The question of centralised agency
formation can be left open.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
For member states with national authorities, an additional element can be suggested by reference to positive
comity co-operation. This would provide that where a
member state believes distortion in trade has occurred either in regard to its exports, that the authority of the subject member state will be obligated to investigate the matter and act to secure a competition policy remedy for the
designated practice.
&RQFOXVLRQ
There are other competition policy considerations
which may distinctly flow from the determination to form
a customs union. For the purposes of simplification, this
essay has chosen to focus on one fundamental policy inherent to customs union formations, that being the goal of
providing for free internal circulation and the elimination
of contingent trade measures between members states. By
doing so, it is hoped to illustrate that the choice of a legal
form selected for a regional grouping has implications for
the creation of additional policies which may be necessary to give this decision legal effect. For customs unions,
competition policy may be viewed as the mechanism
which drives the process of integration forward to the
completion of a customs territory.
6RXUFHV:
Holmes, Peter, and Mathis, James, (1997) (XURSH
$JUHHPHQW&RPSHWLWLRQ3ROLF\IRUWKH/RQJ7HUPDQ$F
FHVVLRQ2ULHQWHG$Sproach, in Rules of Competition and
East-West Integration, Fritsch M., and Hansen H., (eds.)
Kluwer Academic Publishers, Dordrecht.
Marceau, Gabrielle (1995), 7KH )XOO 3RWHQWLDO RI
WKH (XURSH$JUHHPHQWV7UDGHDQG&RPSHWLWLRQ,VVXHV
WKH &DVH RI 3RODQG, World Competition, V. 19, No. 2,
pp. 35-69.
Mathis, J. H., (1996,QWHUQDWLRQDO$QWLWUXVW5XOHVDQG
WKH Role of National Trade Measures, in van Mourik, A.,
(ed)., Developments in European Competition Policy,
European Institute of Public Adminstration (EIPA),
Maastricht.
Nicolaides, Phedon, and Mathis, James, (1996), (XUR
SHDQ &RPPXQLW\ &RPSHWLWLRQ 5XOHV LQ WKH $VVRFLDWHG
&RXQWULHVRI&HQWUDODQG(DVWHUQ(XURSH+RZWR(QVXUH
(IIHFWLYH (QIRUFHPHQW, Aussenwirtschaft, V. 51:4,
pp. 485-512.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
&RPSHWLWLRQSROLF\DQGVPDOORSHQHFRQRPLHV
LQYHVWPHQWWUDGHDQGFRPSHWLWLRQSROLF\
LQGHYHORSLQJFRXQWULHVDQGVRPHLPSOLFDWLRQVIRU&20(6$
%\0DUN:DUQHU
OECD
This study discusses the relationship between competition policy development in small open economies. The
aim of the study is to identify and analyze the main issues
and options for small open economies to undertake policies to strengthen competition in the context of development and regional integration in the Common Market for
Eastern and Southern African Countries (“COMESA”).
mies cannot forestall all of the effects of anticompetitive
practices, and thus competition policy of some form can
serve as a useful complement.
Drawing on the first two sections of the paper, the concluding section of the paper sets out briefly a template of
elements that might be included in a competition law for
small economies on their own, or within the framework of
a regional economic integration agreement. It is worth
stressing at the outset that this study is at this stage is solely one of a conceptual nature. No attempt has been made
at this stage to translate this analysis to particular legislative or policy directions for future COMESA negotiations.
The first section makes the point that the relevance of
competition policy issues is not related to the size of an
economy but to certain characteristics of its markets, such
as entry barriers, market power and asymmetrical information. A key conclusion of this section is that the
strengthening of competition within an economy may often enhance welfare and reduce barriers to trade in such
economies. One question that requires further work, however, is whether a horizontal competition law of broad application is essential to fostering competition, or whether
other policy measures which emphasize competition principles can establish competition within small open
economies.
6HFWLRQ0DUNHWVL]HDQGPDUNHWVWUXFWXUH
There is no DSULRUL reason to believe that competition
law and policy is only relevant to relatively large open or
closed economies. Competition law and policy are concerned principally two things. One concern is with collusion between or among competitors who agree to, in effect, set price or quantity in a particular market such that
consumers pay more for goods and services than would be
the as in the absence of such agreements.
The second section surveys how small countries have
approached competition law in various regional trading
arrangements in Europe, Asia and Africa. Several points
emerge from that review. First, in the European Union
context small economies have had to participate to some
degree in the implementation of competition law and
policy whether they be actual or prospective Members of
the EU, or Members of free trade agreements with the EU.
This has assured that from the point of view of trade there
is some degree of a level playing field among economic
agents acting within the economic space. Notwithstanding this fact, these rules have had more of the character of
a “floor” rather than a “ceiling” such small economies are
have not been required to have extensive national laws,
although some have chosen to implement them of their
own choice.
Another concern of competition law and policy is with
exclusion by a firm or, perhaps firms acting together, to
exclude competitors from a particular market such that
prices to consumers are increased. Competition law addresses this problem by prohibiting a firm from wilfully
obtaining or attempting to obtain a monopoly by any
means other than a superior skill, foresight and industry.
Viewed in this way, the size of a firm is not problematic
in and of itself, rather the issue is what a firm does with its
size and how it obtains its size. Accordingly, competition
law tends to deal with dominance and monopolisation by
focusing on abusive or exclusionary conduct. The problem for policy is balancing the desire to urge a competitor
to compete, and punishing it for competing successfully.
In the Tasman context, the survey shows that some degree of competition policy convergence and integration
was essential to the integration of the smaller New Zealand economy with Australia. It is too early to determine
clear trends from Asia and Africa. Some relatively small
economies have implemented competition laws, but most
have not yet done so. However, as discussion and negotiation of economic integration progressed so too has the
prominence given to competition policy both at national
level and within regional trading arrangements. There appears to be increasing awareness that open liberal econo-
A related concern of competition policy is with mergers that can sometimes produce market structures which
are anti-competitive in the sense of making it easier for a
group of firms to cartelise a market, or enabling the
merged entity to act more like a monopolist. That is, when
there are fewer firms in the market, it becomes easier for
them to compete less vigorously and even collude. Also,
if the merged entity gains market power, the concerns
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
about exclusion, monopolization and abuse of dominance
come to the fore.
economy could render the domestic exclusion strategy
profitable to the detriment of the local consumers.
That being said, there is a debate about the incentives
to engage in successful collusion or exclusion in open
economies. In an open economy, a certain proportion of
goods and services are tradable, and a certain proportion
are non-tradable. The distinction between the closed
economy and the open economy is less relevant for nontradable goods and services because foreign imports do
not compete with local goods and services to discipline
prices. However, in an open economy tradable goods and
services face some degree of competition from foreign
sources. The degree of competition will vary to some extent with the nature of the good and service in question,
transportation and distribution costs etc.
Thus far the analysis in this section of the paper has focussed on why competition policy might be beneficial to
small open and closed economies having regard principally to domestic anticompetitive practices. It is also true
that certain anti-competitive practices may originate in
other countries may affect competition in the country,
such as international cartels that rig bids, fix prices or divide or allocate markets, anticompetitive international
mergers and acquisitions and exclusionary practices engaged in by foreign or multinational firms with regional
or global dominant positions in particular relevant product markets.
However, where foreign goods and services provide
actual or potential competition, then collusion should be
less likely because a price rise above the competitive level
should induce a foreign supply response. Of course, the
colluding domestic firms could try to make the collusion
successful by incorporating the foreign firms into the
scheme. The likelihood of such successful international
collusion would be limited over time because the incentives for cheating and defection among members would
increase as the numbers increase, and alternatively stated
the costs of policing and monitoring such agreements
would increase as the number of participating firms increased. However, in the interim, consumers would suffer
be harmed from higher prices and reduced choices.
Furthermore, it should be stressed that obstacles to competition are not always the result of the strategic behaviour by firms, but are often the result of inconsistent domestic policies, such as regulatory and trade policies. In
such cases, collusion that would not be successful in an
open economy, might otherwise succeed.
With respect to exclusion, the analysis of the closed
economy is similar to the analysis of collusion above. A
firm in the closed economy will, by definition, not be subject to competition from foreign sources that might render
the exclusion strategies unprofitable. However, an open
economy context is not a guarantee that exclusion strategies cannot be successful. Consider an example where a
dominant firm producing widgets, attempts to exclude a
competitor (foreign or domestic) by having all the local
distributors agree only to sell its widgets. In that case, the
dominant firm could raise the costs of entering the market
by requiring both foreign and domestic entrants to establish or develop their own alternate distribution channels.
In such a case, an open economy would not be a guarantee
that exclusion strategies would be unprofitable. Again, it
should be stressed that this problem is not dependent solely on the strategic behaviour of a firm. Rather, firms
might profit from existing regulatory entry barriers that
facilitate their own exclusionary actions or intentions.
The example above also shows that the size of the
economy might also influence the successfulness of the
predation strategy. The foreign entrant might judge that
the relative costs of setting up the alternate distribution
network to be too high relative to the potential profits to
be gained from serving that economy. In that case, the absence of economies of scale and scope in the small open
In such cases, a domestic competition policy might be
a useful tool to address these challenges to competition
that harm consumers, and certain producers in the case of
anticompetitive exclusion, in the domestic economy.
However, it may also be the case that a small economy
acting alone would not necessarily have effective remedies to these anticompetitive practices that originate outside of their borders. Accordingly, such economies might
opt to “free ride” on the enforcement initiatives of larger
economies, however that will not work in situations
where the anticompetitive effects occur in the small
economy, but not in other larger economies. Similarly,
remedies crafted in other larger countries will not always
address the particular anticompetitive effects occurring in
the smaller economy. Alternatively, the smaller economy
may opt for some form of international enforcement cooperation, however having a credible domestic competition law in effect may be a precondition for any successful
enforcement cooperation.
What this analysis demonstrates, therefore, is that
competition policy directed at collusion and exclusion in
the small open economy may serve a useful purpose. The
question that remains is whether a horizontal competition
law is necessary to insure that competition is maintained
in the local markets. With respect to exclusion, answering
this question involves an analysis of the structure of the
local market that might give rise to successful predatory
strategies. It may be the case, that at the root of the problem are barriers to entry that are regulatory in nature, and
that if these barriers are removed then the likelihood of
successful exclusion could be reduced. Similarly, with respect to collusion, it may be that asymmetries between the
information available to firms and consumers, permits the
collusion among firms to go undetected. Accordingly, it is
worth considering whether there are not other means of
addressing such informational asymmetries without
creating a horizontal competition law.
Given the limited resources available to small economy, there must be some principled way of engaging in a
cost/benefit analysis of a horizontal competition law as
opposed to competition principles that inform the whole
panoply of government policy measures. It may be the
case, that in the small economy, problems of exclusion
can be dealt with adequately by a combination of open
trade and liberal regulatory policies. It may also be the
case that in the small economy, issues of collusion are
more difficult to address simply by open trade and liberal
regulatory policies. That does not, however, mean that in
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
the case of collusion, a horizontal competition law is D
SULRUL the optimal policy instrument given resource constraints. It is worth considering whether other laws of general application such as criminal laws directed at conspiracies or fraud, or consumer protection laws might also
be effective.
This section has demonstrated that competition can often be welfare improving to the small economy, and often
help to reduce barriers to trade. Thus laws and policies
that promote competition are often in the interests of the
small economy whether those policies are pursued
through a horizontal competition law, or through a range
of policies that are designed bearing in mind competition
principles.
That being said, it is worth stating that competition law
and policy tends to focus on consumer welfare. It is generally assumed in this analysis that when consumer welfare is enhanced then total welfare is implicitly enhanced.
However, most competition laws do recognize that over
time, consumers are better off if competitors can agree
amongst themselves in respect of innovation, or research
and development. Accordingly, many competition laws
are less hostile to some agreements among competitors, or
joint ventures, or some dominant firm practices where dynamic efficiencies can be clearly proved. Another way of
stating this proposition is that, competition law sometimes give greater weight to producer welfare in the short
term where the concern is with achieving dynamic efficiency objectives over the long term as opposed to static
allocative or productive efficiency objectives.1
However, a focus on dynamic efficiency is not inconsistent with consumer welfare. The exception discussed
above is employed with a view to providing lower prices
and greater choices to consumers over time. However, it
is unlikely that an economy that focussed exclusively on
producer welfare, rather than competition, would achieve
the same measure of lower prices and product choices for
consumers over time. Accordingly, some laws that promote competition would be important even for a small
economy that chose to pursue an innovation-based
approach to economic development.
For certain small and micro economies, the apparent
exceptions from the norm of competition may not be
based solely on dynamic efficiency concerns. It might be
the case that the minimum efficient scale for production
or distribution in some relevant markets is such that only
one producer or distributor could function profitably, or
that several producers and distributors could function
profitably only in some form of cooperative or collaborative joint venture. It is important to note, however, that
this is not necessarily an argument against competition
per se. Rather, what is important is that those markets
1
Allocative efficiency is concerned with ensuring that economic resources are distributed to those who put the greatest value on them. This
is efficiency in exchange. Productive efficiency is concerned with assuring that a given level of output is achieved at the lowest cost. In competitive markets, both allocative and productive efficiency are achieved
at the same point. While allocative and productive efficiency are static
concepts, dynamic efficiency is concerned with the process of discovering the best technologies, processes and products for meeting changing consumer tastes and incorporating them efficiently into the economic system.
remain contestable, in the sense that the incumbent firm
has to make its pricing and output decisions having regard
to potential entry. In other words, there may still be a role
for competition law and policy in ensuring that strategic
and regulatory entry barriers are minimized or eliminated
such that the incumbent firm does indeed face certain
competitive pressures.
The problem of minimum efficient scale in small and
micro economies, however, may not always be resolved
by relying on contestable markets. In some instances, the
apparent need of a firm to have a near monopoly in the local market in order to function a minimum efficient scale,
may indicate that the production or distribution should be
achieved instead by importing goods or by another mode
of supplying the service other than a local presence. Of
course, this will at times, require governments to make
very sensitive and strategic decisions that go to the heart
of their concerns over sovereignty. For instance, few
economies would likely be prepared to do away with a local monopoly for policing and public order simply because some foreign security firm could provide the service more efficiently and at less cost. Similarly, some
industrial and manufacturing sectors might be seen as
having some inherent strategic importance, or some importance as infrastructure that supports other important
sectors of the economy that are indeed subject to competition. The important point to note, is that competition law
and policy can help shape the analysis in these situations
so that the choices made by governments are not based on
private rent seeking and corruption.
This problem can also be posed differently. For instance, it my be the case that some foreign producer or
distributor of a good or service is engaging in collusive
market division and allocation schemes, or using anticomptitive exclusionary vertical agreements in order to
service the local market in the small or micro economy. In
such cases, the local consumers may be adversely affected
by prices above competitive levels. A country with a competition law and policy may be better positioned to counter arguments from such firms that such practices are necessary in order to achieve the scale economies needed to
service the small and micro economies.
Finally, it should be added that when small and micro
economies enter into regional free trade agreements, the
gains from trade from such arrangements are unlikely to
be fully realized in those economies if a significant
number of sectors are exempted from competition.
6HFWLRQ3ROLF\RSWLRQVIRUVPDOOHFRQRPLHV
This Section of the paper discusses the different policy
options countries may adopt, at the national or sub-regional level, to enhance competition in their economies,
taking into account the different sizes of their economies
and the relative burden that establishing competition legislation and institutions would imply. At the outset it
should be stated that there is more evidence to be gained
from the approaches to competition policy in relatively
large developed economies. However, it is possible to
learn from the experience of the adoption of competition
policy among developed countries of varying sizes. Similarly, it is possible to draw out some implications of
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
adopting competition policy among developing countries
of varying sizes. Nonetheless, in terms of SHUFDSLWD incomes some of these small, and even micro, economies
are similar to other countries that have developed, national and regional approaches to the adoption of competition
law. Accordingly, this section of the paper will discuss the
approaches that have been taken to the adoption of competition laws and polices in a range of developed and
developing countries.
$ 6PDOOHUHFRQRPLHVZLWKLQWKH(XURSHDQ8QLRQ
The competition rules applicable to undertakings in the
EU are found principally in Article 85 (general prohibition against anti-competitive practices), Article 86 (abuse
of dominant position) and Article 902 (public undertakings) of the EC Treaty or the Treaty of Rome and in relevant secondary legislation such as the Merger Control
Regulation and various Notices and Block Exemptions.
Article 85 and 86 have direct effect in the 15 Member
states through the national courts. The coherence of the
system is assured by the existence of common EU legislative institutions, the European Council and the European Parliament, a common administrative institution in
the form of the European Commission (“EC”), and common courts, the Court of First Instance which reviews EC
decisions (“CFI”) and the European Court of Justice
(“ECJ”) which hears appeals coming from the CFI and
national courts.
In order for Articles 85 and 86 to be directly applicable
by national competition authorities, national legislation
must expressly provide for that eventuality. Nonetheless,
there is an increasing trend for the EC to cooperate with
national authorities in handling cases under their own national laws, but also in implementing Articles 85 and 86
where authority is allocated to them by the EC in accordance with the principle of “subsidiarity” (e.g. EU decisions should be taken as closely as possible to citizens).3
The smallest Member of the European Union is Luxembourg, and it provides a good example of how the EU
competition system applies to small economies. Luxembourg is subject to EC competition law through the direct
application of Articles 85 and 86 in its national courts, and
through the actions of the EC, CFI and CFJ where a case
involving Luxembourg has a Community dimension.
However, Articles 85 and 86 are not directly applicable
by the Luxembourg national competition authorities.
Luxembourg also has had its own national competition
law since 1970, however the law is not administered by an
independent authority, and has not been vary actively enforced, although there are some recent indications that
this might be beginning to change. The philosophy of enforcement was reflected in a 1997 OECD Annual Report
on Competition Law Developments in Luxembourg
where, Luxembourg stated that it was:
2
Corresponding to Articles 53, 54 and 59 respectively, of the EEA
Agreement.
3
EC Notice on Cooperation Between National Competition
Authorities and the Commission in Handling Cases Falling Within the
Scope of Articles 85 and 86 of the EC Treaty OJ 262, (October 10,
1996). See also EC Notice on Cooperation Between National Courts
and the Commission in Applying Articles 85 and 86 of the EEC Treaty
OJ 39 (February 13, 1993).
“in the process of redefining its position, in light of its
particular economic structure and geographic position.
As Luxembourg is not a major manufacturing country,
it has to import most of its consumer goods. Furthermore its fabric consists essentially of small enterprises,
which find it difficult to compete individually with foreign firms. For this reason, the objectives of competition policy cannot be the same as in neighbouring
countries.”4
Ireland, Denmark, Finland, Austria and the Netherlands may also be considered to be smaller economies
within the EU in terms of relative population size and per
capita GDP. As with Luxembourg, Articles 85 and 86 are
directly applicable by their national courts, but not their
national competition authorities. Unlike Luxembourg,
however, each of these countries has its own independent
competition authority and its own national competition
law.
Several conclusions can be drawn from this brief survey of EC competition rules. First, small and large EU
Members are bound together by certain core principles of
competition policy that must apply to transactions of their
citizens with citizens from other Members, and between
and among their own citizens. However, beyond this
“floor” Members reserve the right to apply their own laws
tailored to their own legal, historical and socio-economic
circumstances. At the centre, the administrative institution, the EC, focuses on the effects of particular practices
on trade between and among the Members. In doing so, it
is increasingly relying on national authorities to take actions at the national level to remedy matters which have a
Community dimension, but a mainly national effect. Although just over half of the Members permit their national
authorities to apply Articles 85 and 86 directly, to an
increasing extent national competition laws are being
revised to be made consistent with Articles 85 and 86.
% 6PDOOHUZHVWHUQ(XURSHDQ(FRQRPLHVRXWVLGHRI
WKH(XURSHDQ8QLRQ
Iceland, Liechtenstein and Norway are contracting parties to the Agreement on the European Economic Area
(“EEA Agreement”) along with the European Community and its individual member states.5 Under the EEA
Agreement, the three countries are obliged to incorporate
the competition rules in the Agreement into domestic legislation The objective of the EEA Agreement is “to promote a continuous and balanced strengthening of trade
and economic relations between the contracting parties
with equal conditions of competition, and the respect of
the same rules, with a view to creating a homogeneous
European Economic Area”. Two important means for attaining these objectives are the implementation of provisions corresponding to the EC provisions regarding the
free movement of goods, persons, services and capital,
and EC competition legislation.
4
OECD Annual Report on Competition Policy in the Grand-Duchy
of Luxembourg DAFFE/CLP(97)11/13.
5
These three countries are the remaining members of the European
Free Trade Area (EFTA) that signed the EEA Agreement. Switzerland
was also an EFTA member, but it did not agree to participate in the
EEA.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
The competition rules applicable to undertakings in the
EEA Agreement, correspond to Article 85, Article 86 and
Article 906 of the EC Treaty and to the relevant secondary
legislation. The regime for merger control under the Treaty also applies under the EEA Agreement. Under this regime the European Commission or the European Free
Trade Area (“EFTA”) Surveillance Authority has the exclusive authority to take decisions on merger cases above
specific thresholds
The EFTA states which are contracting parties to the
EEA Agreement have established a separate institutional
system for decision-making and supervision. The EFTA
Surveillance Authority, located in Brussels, Belgium, and
the EFTA Court, situated in Luxembourg, were established by an agreement between the EFTA countries.7
These two bodies are in charge of surveillance and judicial control with regard to the EFTA countries' fulfilment
of their obligations under the EEA Agreement, and with
regard to the competition rules applicable to undertakings. The EFTA Surveillance Authority is a parallel body
to the European Commission in the field of competition,
and the EFTA Court is a parallel body to the European
Court of Justice.
The EEA Agreement contains provisions on the attribution of cases between the EFTA Surveillance Authority and the Commission in the fields of competition.
The guiding principle is the “one stop shop”, which is intended to avoid the parallel handling of cases. This means
that a decision by one of the authorities should be respected by the other authority. Thus, the agreement contains
specific provisions governing the close cooperation between the two bodies.
Under the EEA Agreement undertakings from each of
the three countries has to comply with both the national
regime and the EEA regime insofar as the practice at hand
has an appreciable effect on trade. For transactions that do
not implicate trade with the European Union, or between
the EFTA countries themselves, each country retains the
right to determine whether or not to enforce a national
competition law.
Of the three EFTA countries, the largest, Norway, has
the most expansive national competition law which is
based on two principles: a prohibition against horizontal
practices generally considered to be anti-competitive and
legal power to intervene in individual cases against other
anti-competitive practices. The Norwegian competition
authority review mergers, but does not require prior notification of mergers. The competition authority has a
statutory right to give its views on competition implications of regulatory and legislative initiatives. On the other
end of the spectrum are the smaller of the three countries
Liechtenstein and Iceland which do not have a national
competition law.
Before leaving this section, it is worth considering the
case of Switzerland, the one EFTA country that did not
join the EEA Agreement. Swiss competition law was sub6
Corresponding to Articles 53, 54 and 59 respectively, of the EEA
Agreement.
7
The Agreement between the EFTA States on Establishing a Surveillance Authority and a Court of Justice.
stantially revised in 1995, and in many respects it is now
broadly similar to EC law. Prior to 1995, Switzerland did
not distinguish between agreements among competitors
and dominant positions. The revised law adopts the distinction along the lines of Articles 85 and 86 of the Treaty
of Rome, however unlike the prohibition and exemption
system for cartels in Article 85, the Swiss law requires all
cartels to be notified and authorized. However, the law
contains broad guidance as to the types of cartels that will
not be authorized so the distinction may not be as great as
it first appears. The Swiss law also adopts a pre-merger
notification system, and the substantive analysis of mergers is very similar to that under the EC Merger Regulation.
&
6PDOOHUFHQWUDODQGHDVWHUQ(XURSHDQ(FRQRPLHV
The competition rules prevailing between the European Union and the Associated Countries of Central and
Eastern Europe are contained in bilateral agreements.
They are part of the so-called “Europe Agreements”,
which concern a broader set of policies. In the period between 1991 and 1996, the European Union has concluded
such agreements with Poland, Hungary, the Czech Republic, Slovakia, Estonia, Lithuania, Latvia, Slovenia,
Romania, and Bulgaria. The Europe Agreements tackle a
number of competition issues directly through explicit
provisions, but they also go further than that by containing a clause on approximation of legislation. These two
aspects clearly illustrate the idea that liberalization of
trade goes in parallel with adopting regulations in the field
of competition. More generally, it fits into the philosophy
that governments are required to enforce competition
rules in their countries as a condition for being admitted
as players in a globalized economy.
• Agreements that are deemed to be incompatible with
the proper functioning of the Europe Agreements, in
so far as they distort trade with the EU are:
• All agreements between undertakings, decisions by
associations of undertakings and concerted practices
between undertakings which have as their object or
effect the prevention, restriction or distortion of
competition. (Article 85)
• An abuse by one or more undertakings of a dominant
position in the EU or the other associated country.
(Article 86)
• Any public aid which distorts or threatens to distort
competition by favouring certain undertakings or the
production of certain goods. (Article 92)
In addition, the Europe Agreements require that undertakings with special or exclusive rights be subject to rules
that are consistent with Article 90 of the EC Treaty.
Similarly, state monopolies of a commercial character are
to be treated as under Article 37 of the EC Treaty such that
there is no discrimination in government procurement.
These agreements carry with them an obligation for the
aspirant to “approximate” the EU competition law, and
creates some common institutions for ensuring that the aspirant’s competition authorities do so in fact. No similar
approximation requirement was ever made explicitly part
of a process of an EC enlargement exercise before which
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
in part explains why only 8 of the 15 member states directly apply Articles 85 and 86. Further, it is worth noting
that antidumping remedies are still applicable to trade
from countries subject to Europe agreements despite the
approximation process. Interestingly, the Council and the
Commission have signalled first in respect of trade negotiations with South Africa, and subsequently in its negotiation strategy for the next renewal of Lomé IV in 2000,
competition policy enforcement will be a required
element.
It is interesting to note that as the EU continues to expand, the principle of “subsidiarity”—i.e. decisions
should be taken at the national level wherever possible—
takes on greater importance. Over the last few years,
greater reliance has been put on national courts and national competition authorities within existing EU members. More recently, the Commission has proposed
sweeping changes to Article 85 and 86 that will result in
further authority being exercised at the national level.
This is due in large part to the accession of new Member
States in the foreseeable future which is becoming an ever
more real prospect. In March 1998, negotiations for accession were initiated with a first group of six candidate
countries (Poland, the Czech Republic, Hungary, Estonia,
Slovenia, and Cyprus). A further five countries (Romania,
Bulgaria, Slovakia, Latvia, Lithuania) are continuing
their preparations with a view to opening accession negotiations at a later stage. Thus, a European Union with
more than twenty-five Member States is on the horizon.
The EU thus faces three main challenges: how to bridge
the enormous economic gap between old and new Member States; how to avoid market distortions between advanced free-market countries and those completing their
transition to a market economy; and how to adapt the institutional and procedural laws, which were designed for
a much smaller Community in order to keep the system
workable and to allow the integration process to continue.
An interesting element of the “approximation” process
is that the parties to the Europe Agreements were required
to approximate to EC law as it existed even in cases such
as with respect to vertical agreements where the balance
of academic opinion has found that law to be overly restrictive. The irony that resulted is that once these countries having approximated their laws, the EC began the
process of fundamentally reforming its approach to vertical restraints to be far less restrictive. Similarly, as many
of these economies were moving from state-owned enterprises and centralized regulatory regimes, many wanted
to apply more stringent rules for abuse of dominance than
existed under EC law. In this case, however, the EC
seemed to require its own law as a floor rather than a ceiling thus permitting the transition economies to enact
stronger laws on abuse o dominance.
' $1=&(57$
The Tasman experience with trade and competition
policy rule making is also of interest. In 1983, Australia
and New Zealand entered into the Closer Economic Relations Agreement (“CER”) to provide for free trade in
goods, but not services, over a seven year period. In 1988,
the two countries entered into the Australia New Zealand
Closer Economic Relations Trade Agreement
(“ANZCERTA”) in 1988 to expedite the process of liber-
alizing trade in goods. The ANZCERTA also abolished
antidumping remedies for intra-Tasman trade much as the
Treaty of Rome had done from its inception for trade
among the member states of the European Union.
Instead both countries agreed to apply their respective
competition law provisions to abuses of market power to
deal with cross-border issues of predatory pricing. This
agreement was facilitated in large measure by the gradual
reform of New Zealand competition law, culminating in
statutory amendments in 1986, to conform to Australian
precedent. Interestingly, in 1986 New Zealand did not
copy the Australian provisions on price discrimination,
and Australia itself abolished these provisions in 1996
To be clear, differences remain in each countries competition laws with respect to market power thresholds, efficiency exceptions and public benefits tests. For instance, with respect to mergers, Australia applies the
concept of market power, while New Zealand applies the
concept of dominance. While these are similar concepts,
the former is a narrower concept linked to the ability of a
firm to impose a significant non-transitory price increase,
but the latter is a broader concept that asks whether a firm
is able to choose its conduct without taking account of
eventual reactions of competitors and suppliers.
Nonetheless, there have been few government investigations, no reported government decisions using these
cross-border provisions, and only one private case that
was dismissed on largely procedural grounds. Interestingly, since the abolition of anti-dumping remedies for intraTasman trade, anti-dumping remedies have increased dramatically against non-Tasman countries.
The Tasman approach to anti-dumping places it as a
hybrid between the European and North American models. In particular, it is worth noting that there has been no
attempt to move towards a complete harmonization of national laws or centralization of Tasman competition enforcement. While there are interesting provisions facilitating cross-border investigations in these cases, and
provisions for judges from one country to become involved in decisions in another, in all other respects Tasman competition policy enforcement is governed by a
1994 Co-operation and Coordination Agreement between
the Australian Trade Practices Commission and the New
Zealand Commerce Commission, and mutual legal assistance legislation in both countries relation to business
regulation and criminal matters. One especially interesting feature, however, is the explicit provision for the regular exchange of staff every six months. This represents a
cautious nod in the direction of further convergence.
(
$3(&
The Asia-Pacific Economic Cooperation Council
(“APEC”) was formed in 1989. It is neither a formalized
free trade agreement, nor as developed a policy and discussion institution as the Organization for Economic Cooperation and Development (“OECD”). In Osaka in 1995,
the APEC Economic Leaders adopted an “Action Plan” in
15 specific areas – competition policy was one such area
and deregulation was another. (In 1996, a decision was
taken to fold the work on competition and deregulation together.) APEC Members have developed both “Collec-
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
tive Action Plans” and “Individual Action Plans” in each
of these areas.
6. Consider developing non-binding principles on
competition policy and/or laws in APEC.
With respect to competition policy, the Collective
Action Plan establishes the objective of enhancing:
With respect to deregulation, the Collective Action
Plan establishes the objectives of promoting the transparency of their respective regulatory regimes; and eliminating trade and investment distortion arising from domestic
regulations which not only impede free and open trade
and investment in the Asia-Pacific region but also are
more trade and/or investment restricting than necessary to
fulfil a legitimate objective.
“The competitive environment in the Asia-Pacific region by introducing or maintaining effective and adequate competition policy and/or laws and associated
enforcement policies, ensuring the transparency of the
above, and promoting cooperation among APEC
economies, thereby maximizing, inter-alia, the efficient operation of markets, competition among producers and traders, and consumer benefits.”
To achieve this objective, each APEC economy agreed
to follow three guidelines:
• Review its respective competition policy and/or laws
and the enforcement thereof in terms of transparency;
• Implement as appropriate technical assistance in regard to policy development, legislative drafting, and
the constitution, powers and functions of appropriate
enforcement agencies; and
• Establish appropriate cooperation arrangements
among APEC economies.
With respect to the Collective Action Plans, the APEC
economies agreed to:
1. Gather information and promote dialogue on and
study on:
The Collective Action Plan with respect to deregulation provided that the APEC economies, taking into
account work done in other areas of APEC would:
• Publish annual reports detailing actions taken by
APEC economies to deregulate their domestic regulatory regimes; and
• Develop further actions taking into account the
above reports, including;
• Policy dialogue on APEC economies’ experiences in
regard to best practices in deregulation, including
the use of individual case studies to assist in the design and implementation of deregulatory measures,
and consideration of further options for a work program which may include:
• Identification of common priority areas and sectors
for deregulation;
• Provision of technical assistance in designing and
implementing deregulation measures; and
• Examination of the possibility of establishing APEC
guidelines on domestic deregulation; and
• The objectives, necessity, role and operation of each
APEC economy's competition policy and/or laws
and administrative procedures, thereby establishing
a database on competition policy;
• Regular dialogue with the business community, including a possible symposium.
• Competition policy issues that impact on trade and
investment flows in the Asia-Pacific region;
It may be useful to examine the Individual Action
Plans for competition policy for a number of APEC Members to see how different economies conceive of competition policy in the process of economic integration.
• Areas for technical assistance and the modalities
thereof, including exchange and training programmes for officials in charge of competition policy, taking into account the availability of resources;
and
• The inter-relationship between competition policy
and/or laws and other policies related to trade and
investment;
2. Deepen competition policy dialogue between
APEC economies and relevant international organizations;
3. Continue to develop understanding in the APEC
business community of competition policy and/or laws
and administrative procedures;
Hong Kong, a country without a competition law, indicated that it:
“Subscribes to the basic economic philosophy of minimum government intervention in market forces and is
fully committed to the promotion of free trade and competition. Where necessary, appropriate and pragmatic
measures will be taken to rectify any unfair business practices, safeguard competition and protect consumer interests.”
And with respect to deregulation, Hong Kong stated:
4. Encourage cooperation among the competition authorities of APEC economies with regard to information
exchange, notification and consultation;
“Hong Kong believes in market forces and adopts a
hands-off approach to economic management. Its regulatory regimes are established to provide prudential supervision, ensure safety, protect consumer interests, and to
encourage investment. Most of the public utilities are privately owned.”
5. Contribute to the use of trade and competition
laws, policies and measures that promote free and open
trade, investment and competition; and
Other than that, Hong Kong committed to open competition in the telecommunications and energy sectors and
with respect to certain professional services, and to study
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
whether any further administrative and legislative measures are required to improve the competitive conditions in
Hong Kong. Hong Kong did not make any commitments
beyond 2000.
Another clear expression of the Hong Kong approach
to competition policy can be found in a 1997 submission
to the WTO Working Group on the Interaction between
Trade and Competition Policy. There, Hong Kong stated
that:
“It is committed to the promotion of competition. This
is the means to enhance economic efficiency, which is
the ultimate, shared objective of HKC's competition
and trade policies. A fundamental test of whether competition exists is whether the market is accessible and
contestable.
Although competition thrives best on the free force of
the market, some degree of government involvement is
sometimes called for. It is necessary, for instance, for
the Government to put in place a package of legislation
to outlaw deceptive trade practices and protect the fundamental rights of consumers. There may also be circumstances where a very high level of investment is involved (as in the broadcasting business), where
prudential supervision or regulatory efficiency is needed (as in the banking and financial services sectors), or
where the longer term interest of consumers is at stake
(as in the provision of utility services). In such circumstances, the HKSARG will ensure that the monopolistic or oligopolistic situation that is allowed to exist
does not unduly compromise, amongst other things,
the quality of services and the price that consumers
have to pay.
The needs, requirements and characteristics of individual sectors vary. Accordingly, HKC adopts a sector-specific approach to safeguard competition. The
Government also reviews these regulatory measures
periodically to ensure they still meet the needs of prevailing circumstances. Where possible, it will undertake liberalization initiatives to promote competition in
these sectors. . . .
Whilst promoting competition is important, it is a
means rather than an end in itself. The HKSARG has
to strike a delicate balance between the promotion of
competition and other government policies and weigh
these against what is best for the economy as a
whole.”8
Singapore noted that it “does not maintain competition
laws but depends on its free and open market to ensure a
competitive environment in the domestic economy.” It
further noted that for services which the Government has
traditionally been the sole provider, the Singapore Government has commenced a programme of corporatization
and privatization to subject the provision of such services
to competition and market discipline. Examples include:
broadcasting, telecommunications and maritime and post
services. Singapore made very limited further commitments from 1997-2010 to: continue to maintain its free
and open market to ensure a competitive environment in
8
WTO, Submission from Hong Kong, China WT/WGTCP/W/53
(4 December 1997).
the domestic economy;for services which the Government has traditionally provided, continue to review and
introduce competition through privatization where appropriate; and continue to participate in competition policy
dialogues among APEC economies to enhance mutual
understanding of competition policy and laws.
Similarly, with respect to deregulation Singapore stated that it:
“believes in the discipline of market forces and has, in
the past few years, embarked on a programme to corporatize/privatize the provision of major public services.
These include electricity, gas, telecommunications, local
transport (including train, bus and taxi services), broadcasting and postal services.
Regulation, where applied, is to provide prudential
supervision (for example, in the financial services sector),
ensure public safety, protect consumer interests, protect
national security interests and ensure that the Singapore
market is not over-supplied.”
The Singapore statement is particularly interesting because it seems to go right to the heart of the merits of competition policy. As discussed in the first section, competition policy normally promotes consumer welfare by
promoting competition such that prices to consumers are
bid down. However, Singapore, expressly provides for
regulation to prevent “over-supply” which might be
thought of as a mechanism for reducing prices to consumers.
Singapore and Hong Kong are both dynamic relatively
developed developing countries with a strong manufacturing base and active service economy. Therefore, it
might be useful to also have regard to smaller, less developed APEC Members. Brunei Darussalam is a small but
wealthy oil producing state undertook to publish and
make available any competition laws enacted in the future; participate in dialogues/workshops/seminars on
competition policy; facilitate the establishment of a
national consumer protection body.
By contrast, Papua New Guinea, a lower middle income developing country actually undertook to Formulate a consumer protection law, introduction of business
practices act, national competition policy and appropriate
technical assistance and policy development, legislative
drafting powers and functions of appropriate enforcing
agencies. It also committed to deregulate price control
mechanisms and to review existing contractual agreements the state has entered with investors.
The APEC Individual Action Plans for the much larger
APEC members with a substantial manufacturing base,
developed service sector but which are lower middle and
upper middle income countries respectively in terms of
per capita GNP, Indonesia and Malaysia are also of interest. Malaysia indicated a short to medium term intention
to enact a law to address “unethical trade measures and
abuse of market power”. Indonesia, however, indicated
that it already had laws “to protect consumers and business from unfair competition in business activities., and
accordingly it undertook to promote transparency and deregulation in the short to medium term. Both of these Individual Action Plans have been superseded by the Finan-
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
cial Crisis which prompted Indonesia to pass a
comprehensive competition law in March 1999, while
Malaysia continues drafting a law at present.
—Rule of reason approach
The new Indonesian Law Prohibiting Monopoly Practices and Unhealthy Business Competition reflects the
turmoil in which it was drafted. Accordingly, while it
probably should not serve as a model competition law
in its particulars, it does broadly reflect the concerns outlined in the first section of this paper. It contains
provisions in conspiracies and cartels, monopolies and
dominant positions. It provides for merger review, but
not pre-merger notification. It also includes rather complex provisions on interlocking directorates and shareholding that reflect local market structure concerns. The
law also establishes an independent Business Competition Commission with the power to investigate and to impose fines and administrative remedies. The law includes
exemptions for export cartels, research and development
agreements and some small scale businesses.
—Effective and accountable enforcement
Notwithstanding the disparate positions of the APEC
Members on the importance of competition policy to development and economic integration, APEC Ministers
agreed in Kuala Lumpur in 1998 that APEC would examine the possibility of APEC principles for competition
policy and deregulation in 1999. Work is now underway
towards developing a set of core APEC competition and
regulatory principles in for discussion at the next Ministerial meeting in Fall 1999.
Much of the work on developing those principles has
been conducted under the auspices of the Pacific Economic Cooperation Council (“PECC”) a grouping that includes representatives from business, government and the
academic communities. The PECC Competition Principles have not been approved by APEC, but have become
“an important reference document” for the work of the
APEC Working Group on Competition Policy. The PECC
Competition Principles consist of four “First-Level Core
Principles” for the application of competition policy—
comprehensiveness transparency, accountability and nondiscrimination. The “Second Level Principles relate to
government interventions, rules for business codex, and
cooperation between international competition agencies.
They include the following items:
• Review of existing and new government interventions with a view to identifying distortions to the
competitive process
• Progressive elimination of efficiency-reducing regulatory barriers and other interventions
• Minimize the risk of ‘re-regulation’ via anti-competitive business conduct—by effective enforcement of
appropriate competition disciplines
• Where a general competition law is considered
appropriate, its characteristics to include:
—Focused objective (promoting competition and
efficiency)
—Prohibitions of specific business practices only
where these are unambiguously harmful to efficiency and welfare
—Minimal exemptions
—Access by complainants to relevant authorities
—Cooperation between national competition agencies/authorities especially for avoiding/managing
jurisdictional conflict
—Robust protection of confidential business information
The APEC Ministers adopted the PECC First Level
Core Principles in Auckland, New Zealand on September
13, 1999.9
)
$IULFD
It is also instructive to examine the Treaty Establishing
the Common Market for Eastern and Southern Africa10
The 21 Members are: Angola, Burundi, Comoros, Democratic Republic of Congo, Djibouti, Egypt, Eritrea, Ethiopia, Kenya, Lesotho, Madagascar, Malawi, Mauritius, Mozambique, Namibia, Rwanda, Seychelles, Sudan,
Swaziland, Tanzania, Uganda, Zambia and Zimbabwe.
COMESA’s mandate is to promote “outward-oriented”
regional integration through trade and investment.11
COMESA has agreed to establish a free trade area by
October 2000, as a prelude to establishing a customs union
in 2004.
Perhaps, the most interesting provision of this treaty is
its embrace of competition policy in Article 5:
“1. The Member States agree that any practice which
negates the objective of free and liberalised trade shall be
prohibited. To this end, the Member States agree to prohibit any agreement between undertakings or concerted
practice which has as its objective or effect the prevention, restriction or distortion of competition within the
Common Market.
2. The Council may declare the provisions of paragraph 1 of this Article inapplicable in the case of:
(D) any agreement or category thereof between undertakings;
(E) any decision by association of undertakings;
(F) any concerted practice or category thereof;
which improves production or distribution of goods or
promotes technical or economic progress and has the
effect of enabling consumers a fair share of the benefits:
Provided that the agreement, decision or practice does
not impose on the undertaking restrictions inconsistent
9
See: APEC Economic Leaders’ Declaration, http://
www.apec.govt.nz/n/index.htm.
10
33 I.L.M. 1067; (1994) (signed November 5, 1993).
11
M.J. Musonda, “A Regional Competition Policy for COMESA
Countries and Implications of an FTA in 2000” A Paper Presented to
the National Seminar on Competition Law and Policy, Lusaka (May
31- June 2, 1999) at 2-3.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
with the attainment of the objectives of this Treaty or has
the effect of eliminating competition.
option is not without controversy as Zambia and Zimbabwe also have competition laws of their own.
3. The Council shall make regulations to regulate competition within the Member States.”
Third, while there is no clear consensus among SADC
or SACU members about future directions for competition law at the national or regional level, many are beginning to express concerns of the need to be able to react to
the large South African firms that are investing or selling
into the region at a tremendous pace. One topical example
of the concerns expressed relates to South African beer
and mining concerns which are acquiring incumbent local
producers throughout the region, and attaining regional
dominant positions in these markets.
What makes this provision all the more interesting is
that of the 21 COMESA Members, only five, Egypt, Kenya, Malawi, Zambia and Zimbabwe have relatively recently enacted competition laws, and a sixth Member,
Mauritius is in the process of drafting a competition law.
Accordingly, COMESA Members are now actively discussing how best to give effect to Article 5 of the Treaty.
There are, at present, considerable differences over the
degree to which either a common competition law or institution should be established, or whether individual
Members should be required to have some law that prohibits anticompetitive agreements or practices that distorts trade and competition within COMESA. What ever
the form of competition law eventually agreed to within
COMESA, the enforcement of the provisions will benefit
from the existing COMESA Court of justice that has the
power to interpret provisions of the treaty, and to adjudicate disputes that arise between COMESA Members
about its interpretation and application.
There are two other Southern African trading arrangements that are potentially relevant: the Southern African
Customs Union (“SACU”) and the Southern African Development Community (“SADC”). SACU consists of
Botswana, Lesotho, Namibia, South Africa and Swaziland. Of these five countries, so far only South Africa has
a competition law, although Botswana may be in the process of drafting one. SADC consists of 14 countries: Angola, Botswana, Democratic Republic of Congo, Lesotho,
Malawi, Mauritius, Mozambique, Namibia, Seychelles,
South Africa, Swaziland, Tanzania, Zambia and Zimbabwe. Of these only three countries, South Africa, Zambia
and Zimbabwe have competition laws, and Mauritius is in
the process of drafting a law.
These three agreements highlight potential problems
associated with introducing competition policy into regional free trade agreements. First, the countries involved
may be subject to conflicting requirements in terms of
competition law if they are members of several regional
trading arrangements.
Second, within both SACU and SADC, the fact that
South Africa, the regional economic power has a competition law, and has recently concluded a free trade agreement with the European Union has put pressure on the
other Members of these arrangements to consider adopting a competition law. The issue is most acute for SACU
Members because of their customs union with South Africa which implies the need for a level playing field across
a range of regulatory policies. SACU Members are considering whether they need individually to adopt a competition law, and if so whether the law should be modelled
on the new South African law, or whether some regional
competition law arrangement should be created. Similar
concerns are arising within SADC, and increasing discussion is being given to whether SADC should establish a
Competition Law Protocol, and if so whether it should be
modelled on the South African law. However, the latter
Before concluding this section, it might be useful to
briefly examine the kind of provisions that are found in
the competition laws of South Africa, Zambia and Zimbabwe. South Africa has by far the most complex law with
provisions prohibiting and exempting certain anticompetitive horizontal agreements similar to Article 85 of the
Treaty of Rome. The South African law also deals with
abuse of dominance, anticompetitive mergers and has certain presumptions about interlocking directorates. The
merger provisions demonstrate how the law is tailored to
the particular history of South Africa. There is a public interest test in evaluating the effects of a merger, however
the factors to be considered are set out in the statute, and
include a narrow provision relating to the ability of small
businesses, or firmV controlled or owned by historically
disadvantaged persons, to become competitive. The
South African law also creates an independent Competition Commission, and provides for effective rights of appeal against its decisions. The Commission has a statutory
right to participate in regulatory proceedings, and to advise the government on the effects on competition of government legislation and policy.
The Zimbabwean law contains provisions prohibiting
and authorizing certain anticompetitive horizontal agreements, monopolies and anticompetitive mergers. The law
creates an independent Industry and Trade Competition
Commission, and establishes rights of appeal against its
decisions. The Commission has the authority to advise the
government generally on all aspects of competition in the
formulation and implementation of government policy.
The Zambian competition law is broadly similar to
both the South African and Zimbabwe competition laws.
6HFWLRQ0RGHOVRIUHJLRQDOLQWHJUDWLRQ
$
1RUWK$PHULFD
I think that several other interesting insights can be
drawn from the North American model of competition
policy enforcement which is characterized by both formal
and informal enforcement cooperation in respect of civil
and criminal maters between competition officials in
Canada and the United States.12
12
Mark A. A. Warner, International Aspects of Competition Policy—
Possible Directions for the FTAA 22 World Competition 1 (1999).
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
In Chapter 15 of the North American Free Trade
Agreement (“NAFTA”), the parties agreed to adopt or
maintain measures to proscribe anticompetitive business
conduct and to consult periodically about the effectiveness of measures undertaken by each party. Furthermore,
the parties agreed to cooperate on issues of competition
law enforcement with respect to: mutual legal assistance;
notification; consultation and exchange of information relating to enforcement. However, the competition provisions are not subject to the dispute settlement provisions
of NAFTA.
In 1990, the Canada-United States Treaty on Mutual
Legal Assistance in Criminal Matters, which was signed
in 1985 came into force.13 Article II sets forth the scope
of application such that the Parties shall provide, in accordance with the provisions of this Treaty, mutual legal
assistance in all matters relating to the investigation, prosecution and suppression of offences. Assistance includes:
examining objects and sites; exchanging information and
objects; locating or identifying persons; serving documents; taking the evidence of persons; providing documents and records; transferring persons in custody; executing requests for searches and seizures. Assistance
must be provided without regard to whether the conduct
under investigation or prosecution in the requesting state
constitutes an offence or may be prosecuted by the requested state. This Treaty is intended solely for mutual legal assistance between the Parties and does not give rise
to a right on the of a private party. Article V limits compliance where: the request is not made in conformity with
the provisions of this Treaty; or execution of the request
is contrary to its public interest, as determined by its Central Authority. The requested state may postpone assistance if execution of the request would interfere with an
ongoing investigation or prosecution in the requested
state.
Article I provides for certain limitations on the use of
information obtained pursuant o the Treaty such that: the
Central Authority of the requested state may require, after
consultation with the Central Authority of the requesting
state, that information or evidence furnished be kept confidential or be disclosed or used only subject to terms and
conditions it may specify; the requesting state must not
disclose or use information or evidence furnished for purposes other than those stated in the request without the
prior consent of the Central Authority of the requested
state. However, information or evidence made public in
the requesting state may be used for any purpose.
In August 1995, Canada and the United States updated
and broadened the 1994 MOU by signing, $&RRSHUDWLYH
(QIRUFHPHQW $JUHHPHQW 5HJDUGLQJ WKH $SSOLFDWLRQ RI
7KHLU &RPSHWLWLRQ DQG 'HFHSWLYH 0DUNHWLQJ 3UDFWLFHV
/DZV (“1995 Cooperative Agreement”).14 The stated purpose of the 1995 Cooperative Agreement is to promote
cooperation and coordination between the competition
authorities of the Parties, to avoid conflicts arising from
the application of the Parties’ competition laws and to
minimize the impact of differences on their respective im13
See 24 International Legal Materials 1092 (1986) and 29 International Legal Materials 1576 (1990).
14
txt.
See:http://www.usdoj.gov/atr/public/international/docs/uscan721.
portant interests, and, in addition, to establish a framework for cooperation and coordination with respect to enforcement of deceptive marketing practices laws.
Article II sets forth when notification of enforcement
activities is required. Each party must, subject to Article X(1), notify the other party in the manner provided by
this Article and Article XII with respect to its enforcement
activities that may affect important interests of the other
party. Enforcement activities that may affect the important interests of the other party and therefore ordinarily require notification include those that:
(D) Are relevant to enforcement activities of the other
party;
(E) Involve anticompetitive activities, other than
mergers or acquisitions, carried out in whole or in part in
the territory of the other party, except where the activities
occurring in the territory of the other party are insubstantial;
(F) Involve mergers or acquisitions in which—one or
more of the parties to the transaction, or—a company controlling one or more of the parties to the transaction, is a
company incorporated or organized under the laws of the
other party or of one of its provinces or states;
(G) Involve conduct believed to have been required,
encouraged or approved by the other party;
(H) Involve remedies that expressly require or prohibit
conduct in the territory of the other party or are otherwise
directed at conduct in the territory of the other party; or
(I) Involve the seeking of information located in the
territory of the other party, whether by personal visit by
officials of a party to the territory of the other party or
otherwise.
Notification pursuant to this Article must ordinarily be
given as soon as a party's competition authorities become
aware that notifiable circumstances are present, and when
certain enumerated events occur.
In Article III, the Parties acknowledge that it is in their
common interest to cooperate in the detection of anticompetitive activities and the enforcement of their competition laws to the extent compatible with their respective
laws and important interests, and within their reasonably
available resources. The Parties further acknowledge that
it is in their common interest to share information which
will facilitate the effective application of their competition laws and promote better understanding of each other's enforcement policies and activities. The Parties will
consider adopting such further arrangements as may be
feasible and desirable to enhance cooperation in the enforcement of their competition laws. Each party's competition authorities will, to the extent compatible with that
party's laws, enforcement policies and other important interests:
(D) Assist the other party's competition authorities,
upon request, in locating and securing evidence and witnesses, and in securing voluntary compliance with requests for information, in the requested party's territory;
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
(E) Inform the other party’s competition authorities
with respect to enforcement activities involving conduct
that may also have an adverse effect on competition within the territory of the other party;
(F) Provide to the other party’s competition authorities, upon request, such information within its possession
as the requesting party’s competition authorities may
specify that is relevant to the requesting party’s enforcement activities; and
(G) Provide the other party’s competition authorities
with any significant information that comes to their attention about anticompetitive activities that may be relevant
to, or may warrant, enforcement activity by the other party’s competition authorities.
Article IV provides for coordination with regard to related matters. Where both Parties' competition authorities
are pursuing enforcement activities with regard to related
matters, they will consider coordination of their enforcement activities. In such matters, the Parties may invoke
such mutual assistance arrangements as may be in force
from time to time. In considering whether particular enforcement activities should be coordinated, either in
whole or in part, the Parties' competition authorities shall
take into account the following factors, among others:
(D) The effect of such coordination on the ability of
both Parties to achieve their respective enforcement
objectives;
(E) The relative abilities of the Parties' competition
authorities to obtain information necessary to conduct the
enforcement activities;
(F) The extent to which either party's competition
authorities can secure effective relief against the anticompetitive activities involved;
(G) the possible reduction of cost to the Parties and to
the persons subject to enforcement activities; and
(H) the potential advantages of coordinated remedies
to the Parties and to the persons subject to the enforcement activities.
In any coordination arrangement, each party’s competition authorities agree to seek to conduct their enforcement activities consistently with the enforcement objectives of the other party’s competition authorities. In the
case of concurrent or coordinated enforcement activities,
the competition authorities of each party must consider,
upon request by the competition authorities of the other
party and where consistent with the requested party’s enforcement interests, ascertaining whether persons that
have provided confidential information in connection
with those enforcement activities will consent to the sharing of such information between the Parties’ competition
authorities. However, either party’s competition authorities may at any time notify the other party’s competition
authorities that they intend to limit or terminate coordinated enforcement and pursue their enforcement activities
independently and subject to the other provisions of this
Agreement.
Article V provides for cooperation regarding anticompetitive activities in one party that adversely affect the in-
terests of the other party. The Parties note that anticompetitive activities may occur within the territory of one
party that, in addition to violating that party’s competition
laws, adversely affect important interests of the other party. The Parties agree that it is in their common interest to
seek relief against anticompetitive activities of this nature. If a party believes that anticompetitive activities carried out in the territory of the other party adversely affect
its important interests, the first party may request that the
other party's competition authorities initiate appropriate
enforcement activities.
The request must be as specific as possible about the
nature of the anticompetitive activities and their effects on
the interests of the party, and must include an offer of
such further information and other cooperation as the requesting party’s competition authorities are able to provide. The requested party’s competition authorities agree
to carefully consider whether to initiate enforcement activities, or to expand ongoing enforcement activities, with
respect to the anticompetitive activities identified in the
request. The requested party’s competition authorities
must promptly inform the requesting party of its decision.
If enforcement activities are initiated, the requested party's competition authorities agree to advise the requesting
party of their outcome and, to the extent possible, of significant interim developments. Nothing in this Article
limits the discretion of the requested party’s competition
authorities under its competition laws and enforcement
policies as to whether to undertake enforcement activities
with respect to the anticompetitive activities identified in
a request, or precludes the requesting party’s competition
authorities from undertaking enforcement activities with
respect to such anticompetitive activities.
Article VI sets forth principles for the avoidance of
conflicts. Within the framework of its own laws and to the
extent compatible with its important interests, each party
agree to, having regard to the purpose of this, give careful
consideration to the other party’s important interests
throughout all phases of its enforcement activities, including decisions regarding the initiation of an investigation
or proceeding, the scope of an investigation or proceeding
and the nature of the remedies or penalties sought in each
case. When a party informs the other that a specific enforcement activity may affect the first party’s important
interests, the second party shall provide timely notice of
developments of significance to those interests.
While an important interest of a party may exist in the
absence of official involvement by the party with the activity in question, it is recognized that such interest would
normally be reflected in antecedent laws, decisions or
statements of policy by its competent authorities. A party’s important interests may be affected at any stage of enforcement activity by the other party. The Parties recognize the desirability of minimizing any adverse effects of
their enforcement activities on each other's important interests, particularly in the choice of remedies. Typically,
the potential for adverse impact on one party’s important
interests arising from enforcement activity by the other
party is less at the investigative stage and greater at the
stage at which conduct is prohibited or penalized, or at
which other forms of remedial orders are imposed. Where
it appears that one party’s enforcement activities may adversely affect the important interests of the other party,
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
each party must consider all appropriate factors, which
may include but are not limited to:
with that party’s laws, any application by a third party for
disclosure of such confidential information.
viii(i) The relative significance to the anticompetitive
activities involved of conduct occurring within
one party’s territory as compared to conduct occurring within that of the other;
The degree to which either party communicates information to the other pursuant to this Agreement may be
subject to and dependent upon the acceptability of the assurances given by the other party with respect to confidentiality and with respect to the purposes for which the
information will be used. Notifications, consultations and
other communications between the Parties in relation to
the agreement are deemed to be confidential. A party may
not, without the consent of the other party, communicate
to its state or provincial authorities information received
from the other party pursuant to notifications or consultations under this Agreement. The party providing the information must consider requests for consent sympathetically, taking into account the other party’s reasons for
seeking disclosure, the risk, if any, that disclosure would
pose for its enforcement activities, and any other relevant
considerations.
vi(ii) The relative significance and foreseeability of
the effects of the anticompetitive activities on
one party’s important interests as compared to
the effects on the other party’s important interests;
v(iii) The presence or absence of a purpose on the part
of those engaged in the anticompetitive activities to affect consumers, suppliers or competitors within the enforcing party’s territory;
ii(iv) The degree of conflict or consistency between
the first party’s enforcement activities (including
remedies) and the other party’s laws or other important interests;
iii(v) Whether private persons, either natural or legal,
will be placed under conflicting requirements by
both Parties;
ii(vi) The existence or absence of reasonable expectations that would be furthered or defeated by the
enforcement activities;
i(vii) The location of relevant assets;
(viii) The degree to which a remedy, in order to be effective, must be carried out within the other party’s territory; and
i(ix) The extent to which enforcement activities of the
other party with respect to the same persons, including judgments or undertakings resulting
from such activities, would be affected.
Article VIII provides that either party may request consultations regarding any matter relating to this Agreement. Article IX further provides that Officials of the Parties’ competition authorities agree to meet at least twice a
year to: exchange information on their current enforcement efforts and priorities in relation to their competition
and deceptive marketing practices laws; exchange information on economic sectors of common interest; discuss
policy changes that they are considering; and discuss other matters of mutual interest relating to the application of
their competition and deceptive marketing practices laws
and the operation of this Agreement.
Article X addresses the issue of confidentiality of information. Notwithstanding any other provision of this
Agreement, neither party is required to communicate information to the other party if such communication is prohibited by the laws of the party possessing the information
or would be incompatible with that party’s important interests. Unless otherwise agreed by the Parties, each party
agrees to, to the fullest extent possible, maintain the confidentiality of any information communicated to it in confidence by the other party under this Agreement. Each
party must oppose, to the fullest extent possible consistent
The notified party may, after the notifying party’s
competition authorities have advised a person who is the
subject of a notification of the enforcement activities referred to in the notification, communicate the fact of the
notification to, and consult with that person concerning
the subject of the notification. The notifying party agrees
to, upon request, promptly inform the notified party of the
time at which the person has, or will be, advised of the
enforcement activities in question.
In general, information communicated in confidence
by a party's competition authorities to the competition
authorities of the other party in the context of enforcement
cooperation or coordination must not be communicated to
third parties or to other agencies of the receiving competition authorities’ government, without the consent of the
competition authorities that provided the information. A
party’s competition authorities may, however, communicate such information to the party’s law enforcement officials for the purpose of competition law enforcement.
Similarly, information communicated in confidence by a
party’s competition authorities to the competition authorities of the other party in the context of enforcement cooperation or coordination must not be used for purposes
other than competition law enforcement, without the consent of the competition authorities that provided the information. Furthermore, nothing in the Agreement requires a
party to take any action, or to refrain from acting, in a
manner that is inconsistent with its existing laws, or
require any change in the laws of the Parties or of their
respective provinces or states.
The 1995 Cooperative Agreement was used in a case
involving Canada Pipe Company Limited and U.S. Pipe
and Foundry Company. Canada Pipe pleaded guilty to
conspiring with U.S. Pipe to have the latter exit the Canadian market for ductile iron pipe. The Director has stated
that he received extensive cooperation from the U.S. Department of Justice which enabled him to secure a record
$2.5 million fine. Another example of international cooperation pursuant to the 1995 Cooperative Agreement
involves the thermal facsimile industry. In 1994, Kanzaki
Specialty Papers Inc., a U.S. company, pleaded guilty in
the Federal Court of Canada to price fixing and was fined
CDN $950,000. Later that year, the court fined Mitsubishi
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
Corporation, of Japan, and its Canadian subsidiary,
Mitsubishi Canada Limited, CDN $950,000 after they entered guilty pleas to price fixing. In 1995, Rittenhouse
Ribbons & Rolls ltd. was fined CDN $98,000 following a
guilty plea to price maintenance. In 1996, New Oji Paper
Co. Ltd. pleaded guilty and was fined CDN $600,000 to a
price fixing conspiracy, and in 1997 Mitsubishi Paper
Mills Ltd. also pleaded guilty and was fined CDN
$850,000. Concurrently, fines have also been imposed in
the United States. Total fines imposed in respect of this
case in Canada were in excess of CDN $3.4 million, and
in excess of U.S $ 10.2 million in the United States.15
It remains to be seen whether the legal instrument is
truly the cause or the effect of a new Canadian disposition
to cooperate in competition law enforcement. The current
Director of the Bureau, Konrad Von Finkenstein recently
noted that cooperation has covered a wide range of enforcement activities including: regular communications at
all levels of the Canadian and U.S. competition authorities; discussions of case theories and market definitions;
and carrying out Internet sweeps together.16 Quaere
whether any of these examples actually require a formal
legal instrument in order to be used. With respect to criminal matters, the Director has given the following examples of cooperation: sharing evidence; coodinating
searches; and condcting parallel coordinated investigations together from start to finish.17 Again, unless confidential information is being shared, it is difficult to see
why any of these examples of cooperation would require
a formal legal instrument in order to be used.
% 7KH(XURSHDQ8QLRQ
From its earliest beginnings in the Treaty of Rome, the
European Community, now the European Union, represented an attempt to bring together a number of sovereign
states for reasons that were more clearly political than
economic. Nonetheless, the early legal foundations of the
Treaty of Rome included competition law principles. It is
worth stating at the outset that in 1957 when the Treaty of
Rome came into effect, Germany alone among the founding members had a competition law. In fact, Germany had
a long tradition of competition policy dating back to the
Fryberg School which emphasized the need to prohibit
cartels. In addition to this, the post-war U.S. backed governments were encouraged to aggressively apply the anticartel law because cartels were seen as providing support
for the fascist Nazi government.
The European example then is one of largely unintegrated markets that were glued together for reasons that
were largely political. Lacking a common currency as an
instrument of price transparency and price intermedia15
See Competition Bureau, Industry Canada, Annual Report Director of Investigation and Research for the Year ended March 31, 1997
(http://strategis.ic.gc.ca/SSG/ct01190e.htm); U.S. Department of Justice, “Justice Department’s Ongoing Probe Into the Fax Paper Industry
Yields More Indictments” (December 13, 1995); and Joel Klein,
“Criminal Enforcement in a Globalized Economy” 3 (February 20,
1997).
16
Von Finckenstein, Konrad, “Speech to the Annual Meeting Of
The American Bar Association Antitrust Section”, http://strategis.ic.gc.ca/SSG/ct01297e.html (August 3, 1998).
17
Ibid.
tion, and maintaining different regulatory frameworks
and traditions—although mostly activist ones—competition policy soon became, arguably, the single most important instrument of market integration. This was accomplished in the main by a competition policy that would
have been, in many respects, fairly consistent with the
post-war ebb of U.S. competition policy enforcement. To
the antitrust cognoscenti, these were the heart of the pre6\OYDQLD days of the 1970s and thereafter in the U.S. so
vertical restraints were aggressively prosecuted in the
name of market integration.
And it is only recently that the Commission has tentatively proposed that a more modern—more economic—
approach to vertical restraints might be worth considering. And even these cautious steps are made with iron clad
pronouncements that even with an emergent single currency there will be no relaxation of prohibitions on resale
price maintenance or territorial restrictions. This is so despite the economic evidence cited in the Green Paper itself suggesting that price cost differentials remain extraordinarily high in the markets for manufactured
products among the members of the Union. Were this not
bad enough, the Commission’s only power to liberalize its
enforcement of vertical restraints lies either in a finding
that a given agreement, or class of agreements, falls outside the scope of Article 85, or by finding that while it
falls within the scope of Article 85 or 86, it may be exempted under Article 85(3). While the latter finding may
be binding on national authorities, the former clearly
would not be binding on them. Further since, an agreement cannot be exempted under Article 85(3) unless it is
first found to be anticompetitive, in effect a liberal Commission policy to vertical restraints offers n protection
against a reactionary policy from national authorities or
national courts. Re-nationalization by any other name is
simply not centralization.
Not surprisingly, therefore, the European model has
been one of a powerful centralized European Commission
together with first the European Court of Justice, and second the Court of First Instance implementing competition
policy from the European Community to the Single Market. Unlike getting giddy at the thought of the European
model as a complete example of the virtues and practicability of centralization, it is worth recalling that it was
not until 1989 that the Council of Ministers could agree to
Community-wide merger enforcement in the Merger
Regulation. Even so, the price of agreeing to merger review by the Commission was bought by an insistence of
very high thresholds that ensure that only a very few
mega-mergers actually fall under the purview of the Commission. These high thresholds continue to impose high
transaction costs on potential entrants and prospective
merger partners because in effect such parties may still
face duplicative and multiplicative filing requirements in
several member states at once.
In 1996, the Commission issued a Green Paper seeking
to address this, however the major member states imbued
with the currency of subsidiarity and in many cases,
spanking new competition laws, nixed any attempt to
lower the thresholds to provide a true “one stop shop”. Instead, they opted for a complex multijurisdictional threshold that does little to reduce transaction costs or create an
effective “one-stop shop”.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
Obviously embarrassed by their own craven lack of
bravery, and driven by the desire not to be seen to be to
far out of step with the “business friendly” politically correct post-cold war culture, in September 1997 the major
members—Germany, the United Kingdom and France—
created their own common pre-merger notification form
without the barest of nod or wink to the principles of consultation or transparency. What is worse is that it appears
that the new form increases not decreases transaction
costs in each jurisdiction. For instance, in Germany where
the duty to notify mergers has always been wide, but the
duty to disclose information narrow, merging parties in
cross-border transactions have had their compliance costs
raised in effect not by a statutory mandate, but rather by
an intergovernmental agreement. In the U.K., multijurisdictional merger parties seeking expedited review will apparently have to file both the traditional UK form and the
new common form.
And what of the Union? Well, even as the major members seek to cover their policy avarice and institutional
greed through a questionable common form, scant one
month late in October 1997 the Commission issued a new
Notice on Cooperation Between national competition
authorities and the Commission in Handling cases falling
Within the Scope of Articles 85 and 86. Having described
the serious re-nationalization problems that are emerging
in terms of vertical restraints policy and merger enforcement, it now remains to describe the twin attack on a centralized model of European competition enforcement.
The new Notice decentralizes power to a great extent by
authorizing national authorities to enforce the European
competition law where there are mainly local effects even
though clear European effects. At present only 8—Belgium, France, Germany, Greece, Italy, Portugal, Spain
and soon the U.K.—national authorities directly apply
Articles 85 and 86, whereas 7—Austria, Denmark, Finland, Ireland, Luxembourg, the Netherlands, and Sweden—do not.
While proponents of this decentralization would probably argue that no matter how badly the national authorities botch things up, there will still be a single European
competition policy despite the patchwork enforcement
because the Court of first Instance and the European
Court of Justice will be there to remedy any problems. All
of that would be nice and sensible in a world of zero transaction costs, but we have yet to discover or create that
world. Of course, this is just a further development of the
trend embodied in an earlier notice where the Commission sent power back to national courts; see the Notice on
Cooperation Between National Courts and the Commission in applying Articles 85 and 86. It is evident that the
Commission is under funded, however it seems a bit odd
for those who deny it funding to use that as dispositive
proof of the need to re-nationalize or de-centralize European competition enforcement.
Against this backdrop, it is also worth noting the significant role that the Commission is playing in spreading
the European model of competition policy around the
world. First, and foremost, this can be seen in the “Europe
Agreements” or “Association Agreements” described
above. No similar approximation requirement was ever
made explicitly part of a process of an enlargement exercise before which in part explains why only 8 of the 15
member states directly apply Articles 85 and 86. Further,
it is worth noting that antidumping remedies are still applicable to trade from countries subject to Europe agreements despite the approximation process. Interestingly,
the Council and the Commission have signalled first in respect of trade negotiations with South Africa, and subsequently in its negotiation strategy for the next renewal of
Lomé IV in 2000, competition policy enforcement will be
a required element. Thus, the EU, in addition to being an
example of the centralization or decentralization, is also a
model of soft convergence, or perhaps, more appropriately, coerced harmonization. This trend also offers some
useful clues about future attempts to implement competition policy at a multilateral level. It is clear that convergence or harmonization of the growing competition laws
of the world will be an essential pre-condition to any
future progress on this score.
The recent trends towards re-nationalization and decentralization of competition law enforcement within the
EU are not interesting only because for many Europe has
always provided a clear example of a multilateral approach to competition policy. It is all the more interesting
because it also comes precisely at the moment when the
European voice has echoed out with singular clarity in
terms of the need or potential for a more global analysis
off the multilateral option within the framework of the
WTO.
About two things can be said. Where markets are integrated by virtue of a “bottom-up” approach led by multinational corporations, the case for a bilateral or multilateral model of enforcement becomes less compelling. One
could argue that as the Single Market program progresses
there is less need for a centralizing Commission than before. This might be an attractive argument were it not for
the resilience of price-cost disparities among the members of the EU, and cited in both Council and Commission
documents. One might conclude, therefore, that Europe
still needs a centralized competition policy enforcement
model within Europe of the kind that some of her most
senior statesmen call for on the global level. One thing
that is clear, is that achieving a multilateral competition
policy within the framework of an international organization such as the WTO will not be simplified if a microphones are increasingly placed before the cacophony of
voices represented by the national competition authorities
and the national courts. And yes, politics still remain. It
may well be that the European example illustrates much
better than her own statesmen have yet to publicly realize
or admit, that the multilateralizing of competition policy
enforcement is at best a distant dream. Alas, even as we
dare to dream of conquering destructive sovereignty, it
may well be preparing to conquer us yet again.
Let me summarize several conclusions with respect to
the two dominant models of integration- the European
and North American cases. First, unlike the European experience, North American markets have been integrated
from the bottom-up by multinational corporations as is
evidenced by the substantial trade and investment linkages, and in particular the substantial patterns of intrafirm and intra-industry trade. Second, given the size differentials between the U.S. economy and that of Canada
and Mexico, and the substantial population differentials
also, economic integration has been achieved in spite of
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
concerns about political integration not because of them.
In this sense, Europe may well be evolving or converging
towards the North American model prematurely as European markets have simply not achieved the same degree
of economic integration. Nonetheless, this convergence
may offer some practical insights into the limits to the potential for multilateral rule-making in the competition
policy area. Third, the importance of convergence of national law, and underlying economic understanding, was
an essential pre-requisite in moving North American
competition policy from a posture of contention to cooperation. Here again, we can see important parallels to the
movement towards having Article 85 and 86 of the Treaty
of Rome apply directly in the member states, and in the
approximation process in progress in Central and Eastern
Europe, and emerging in Lomé.
tion of competition policy enforcement. Accordingly,
convergence in these regional experiences must draw on
forces from outside the region such as U.S. and European
legal and administrative precedent.
& 6RXWK$PHULFD
' 7KH)7$$
It is also worth considering what the European and
North American experiences suggest for the development
of competition policy in the Andean Community (Venezuela, Columbia, Peru, Bolivia and Ecuador) and Mercosur (Brazil, Argentina, Paraguay and Uruguay). First, although the Andean Community is often compared to the
European Union, with respect to competition policy there
is a notable difference. At the time that the 7UHDW\RI5RPH
was created, and Articles 85 and 86 came into effect, only
one country, Germany really had a tradition of competition policy enforcement. Second, coming out of the ashes
of World War II, the United States sought to have competition policy enforced actively in Germany. Third, Germany remains arguably the most important single economy within the European Union. Accordingly, within the
European Union until very recently the centralization of
competition policy could work because there were no significant competing power centers in the member states.
This has permitted a degree of policy convergence to occur among the member states. In both the Andean Community and Mercosur, the national competition policies
preceded the multilateral or regional instrument, and thus
policy convergence and institutional coordination or centralization are more difficult to achieve. Thus, the 1991
$QGHDQ3DFW'HFLVLRQFRQFHUQLQJ1RUPVIRU3UHYHQ
WLRQRU&RUUHFWLRQRI'LVWRUWLRQVLQ&RPSHWLWLRQ&DXVHG
E\3UDFWLFHVWKDW5HVWULFW)UHH&RPSHWLWLRQ has only rarely been invoked.18 Similarly, the 0HUFRVXU3URWRFRO
RI WKH 'HIHQVH RI &RPSHWLWLRQ KDV RQO\ UHFHQWO\ EHHQ
UDWLILHGE\DOOWKHPHPEHUVWDWHV19 In addition, both the
Andean Community and Mercosur lack a strong driving
force—such as Germany with respect to the EU and the
United States with respect to NAFTA—with a long tradi18
See generally: Jatar Ana Julia and L. Tineo “Competition Policy
in the Andean Countries: The Ups and Downs of a policy in Search of
its Place” 1 The Journal of Latin American Competition Policy (April
1998). (http://www.jlacomp.org); and Taveres J. and L. Tineo, “Competition Policy and Regional Trade: NAFTA, Andean Community,
Mercosur and FTAA” (Unpublished paper presented to the International Seminar on Competition Policy in Celebration of the V Anniversary
of INDECOPI, Lima, Peru May 26-29, 1998).
19
See generally: Tavares J. and L. Tineo, “Harmonization of Competition Policies Among Mercosur Countries” (OAS Trade Unit,
August 1997).
That being said, it is clear that while the South American experience might be superficially closer to the European politically driven integration process, with respect to
competition policy the political environment and legal
heritage has not supported that kind of process. However,
it is less clear that the South American experience tracks
very closely the economic driven model of integration
pursued in NAFTA. Accordingly, it is not surprising that
informal cooperation, convergence and coordination has
also not taken root in either the Andean Community or in
Mercosur.
In the Santiago Declaration in May 1998, the Heads of
State and Government of the Americas directed their
Ministers Responsible for Trade to begin negotiations for
the Free Trade Area of the Americas (“FTAA”), in accordance with the March 1998 Ministerial Declaration of
San José and reaffirmed their determination to conclude
the negotiation of the FTAA no later than 2005, and to
make concrete progress by the end of the century. They
instructed that the FTAA agreement would be balanced,
comprehensive, WTO-consistent and constitute a single
undertaking. In the San José Declaration from March
1998, the Ministers of established nine negotiating groups
on: market access; investment; services; government procurement; dispute settlement; agriculture; intellectual
property rights; subsidies, antidumping and countervailing duties; and competition policy.20
The Ministers acknowledged that work in different
groups may be interrelated, such as agriculture and market access; services and investment; competition policy
and subsidies, antidumping and countervailing duties;
among others. Thus, they directed the Trade Negotiating
Group (the “TNC”) to identify linkages and outline appropriate procedures to ensure timely and effective coordination, and agreed to give the mandate to the relevant
negotiating groups to study issues relating to: the interaction between trade and competition policy, including
antidumping measures; market access and agriculture, in
order to identify any areas that may merit further consideration by the Ministers.
First, it is useful to recall the mandate of the Negotiating Group on Competition Policy (“CP-NG”). The mandate as set forth in the San José Declaration provides one
20
Among the general principles and objectives of these negotiations
identified in the Santiago Declaration are: promoting prosperity
through increased economic integration and free trade among the countries of the hemisphere, which are key factors for raising standards of
living, improving the working conditions of people in the Americas and
better protecting the environment; establishing a Free Trade Area, in
which barriers to trade in goods and services and investment will be
progressively eliminated, concluding negotiations no later than 2005
and achieving concrete progress toward the attainment of this objective
by the end of this century; and maximizing market openness through
high levels of disciplines through a balanced and comprehensive agreement.
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
general objective—to guarantee that the benefits of the
FTAA liberalization process not be undermined by anticompetitive business practices. The Declaration also set
forth two specific objectives for the CP-NG. These are:
(1) to advance towards the establishment of juridical and
institutional coverage at the national, sub-regional or regional level, that proscribes the carrying out of anticompetitive business practices; and (2) to develop mechanisms that facilitate and promote the development of
competition policy and guarantee the enforcement of
regulations on free competition among and within countries of the Hemisphere.
competition laws, and those that are as of yet antitrust
“have nots”. Finally, while the Santiago Declaration provided for the participation of the Tripartite Group of intergovernmental organizations (the Inter-American Development Bank (IADB), the Organization of American
States (OAS), and the United Nations Economic Commission for Latin America and the Caribbean(ECLAC)),
it appears that so far the Antitrust Summit has excluded
the Tripartite Group. It is not clear yet why these distinctions have been made, or what affect these differences
will have on the negotiations.
The June Work Program developed by the Vice-Ministers in Miami further indicates that the CP-NG, and perhaps the should:
In the context of the mandate of the CP-NG, this section of the paper briefly discusses some potential issues
for consideration relating to the application of competition policy in the FTAA.
—Identify main principles and criteria of competition;
—With respect to the principles and objectives set
forth in the San Jose Declaration, guarantee that the
benefits of FTAA liberalization are not undermined
by anticompetitive business;
—Develop mechanisms to promote cooperation and
exchange of information between competition
authorities; and
—Study the interaction between trade and competition
policy, including antidumping measures.
Subsequently, in October 1998, antitrust authorities
from 11 of the 12 nations of the Americas that have competition laws (Argentina, Brazil, Canada, Colombia, Costa Rica, Jamaica, Mexico, Panama, Peru, Venezuela and
the United States) held a Summit an “Antitrust Summit of
the Americas in Panama11 The governments agreed to:
—Promote a “competition culture” among market participants in their countries;
—Enforce “sound” competition laws, particularly in
combating illegal price-fixing, bid-rigging, and market allocation;
—Cooperate in enforcement, and to disseminate “best
practices” for implementing competition laws with
an emphasis on institutional transparency;
—Encourage small economies to develop competition
laws; and
—Advance these principles in the CP-NG.
It appears that the “Antitrust Summits of the Americas” will run in parallel to the work of the CP-NG. It is
worth noting that while so far national delegations to the
CP-NG include competition, trade and foreign affairs officials, by definition, if not just practice, the Antitrust
Summits include only the competition law officials. Another difference is that while the CP-NG is open to all
governments in the FTAA negotiations, the Antitrust
Summits appears to distinguish between those that “have”
21
Chile has a competition law, but did not attend. See FTC Press Release “FTC and DOJ Announce `Communiqué’ from First Antitrust
`Summit of the Americas’ (October 20, 1998). [http://www.ftc.gov/opa/
1998/9810/panama.htm].
&RQFOXVLRQV
This concluding section of the paper draws together the
insights from the first three sections in order to suggest a
template of elements that a small open might consider on
its own or in the context of a regional trading agreement.
The first section demonstrated how even an open small
economy could be adversely affected by anticompetitive
practices from outside of the country, as well as some
from sources within the country too whether from governmental or private firm conduct. However, it was also suggested that there may be qualitatively different aspects of
the market structure or development requirements of
small economies that might require that competition law
be tailored in its application to their specific needs.
The second section of the paper showed how the European Union has adopted certain core principles and common institutions that apply to small and large economy
Members or partners in preferential trading arrangements.
This architecture is designed to preserve and promote the
coherence of the trade between the EU and its partners by
eliminating or reducing trade distortions. However, beyond the floor of the core principles, the small economies
retain significant scope to decide how much competition
policy to apply in the purely national context. It also appears that the deeper the extent of the economic integration pursued, so too does the level of integration of competition policy and its enforcement institutions. This
Tasman experience is consistent with this observation
also.
From the Asian examples, great emphasis has been
placed on the application of competition principles to
many regulatory barriers without emphasizing competition policy to counteract private strategic anticompetitive
behaviour. Notwithstanding this history, economic crises,
and increased discussions of economic integration initiatives have led several countries to now begin to think of
applying a competition law to address private strategic
anticompetitive behaviour. This African experience is
consistent with this observation also.
Accordingly, the rough outlines of a competition law
and policy for a small economy can be drawn from this
survey. Possible elements might include:
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
• Open markets and liberal trade and investment policies.
• Laws to prohibit anticompetitive agreements among
competitors, with exceptions for certain pro-competitive, efficiency-enhancing agreements.
• Laws to prohibit abusive or anticompetitive exclusionary practices by monopolies or dominant firms.
• Laws and institutions to promote competition in the
design and implementation of government regulation and legislation.
• Laws that promote cooperative enforcement among
national authorities to effectively remedy anticompetitive practices having their root outside of the
national economy.
In the context of a regional trading arrangement, at a
minimum these laws should apply to conduct that had a
significant impact on international trade. Countries could
then decide on their own to what extent they want to take
these policies further in the purely national context. Countries could together also decide that given the nature of the
integration that they seek to achieve further common institutions are necessary to eliminate the trade distortions
that arise.
Again, this template is suggested at this stage for heuristic purposes solely. It is worth stressing at the outset
that this study is at this stage is solely one of a conceptual
nature. No attempt has been made at this stage to translate
this analysis to particular legislative or policy directions
for the COMESA negotiations.
5HIHUHQFHV
Ahdar, Rex J., “Antitrust Policy in New Zealand: The
Beginning of a New Era” ,QWHUQDWLRQDO7D[DQG%XVLQHVV
Law Volume 9 (1992).
IDRC project Leading Issues in International Trade Relations/Latin American Trade Network. Buenos Aires (1618 June 1999).
Bollard, Alan E., “The Role of Antitrust in a Small
Open Economy: The Commerce Act in New Zealand,”
5HYLHZRI,QGXVWULDO2UJDQL]DWLRQ Volume 9 (1994)
DeLeon, Ignacio & Omar Enrique Garcia, “Venezuelan Competition Law” ,QWHUQDWLRQDO%XVLQHVV/DZ Volume 21 (1993).
Boner, Roger Alan, and William E. Kovacic, “Antitrust Policy In Ukraine” Vol. 31 *:-,QW
O/(FRQ. 1
(1997).
Fox, E.M., “The Central European Nations and the EU
Waiting Room–Why Must the Central European Nations
Adopt the Competition Law of the European Union”
%URRNO\Q-RXUQDORI,QWHUQDWLRQDO/DZ Vol. 23 (1997).
Boner, Roger Alan, “Antitrust and state action in transition economies; International Competition Policy” $QWL
WUXVW%XOOHWLQ (March 1998).
Garcia-Rodriguez, Sergio, “Mexico’s New Institutional Framework for Antitrust Enforcement,” 'H3DXO /DZ
5HYLHZVolume 44 (1995).
Brezinski, Carolyn, “Competition and Antitrust Law in
Central Europe: Poland, The Czech Republic, Slovakia
and Hungary,” 0LFKLJDQ -RXUQDO RI ,QWHUQDWLRQDO /DZ
Volume 15 (1994).
Gavil, Andrew I., “Cultural Conceptions Of Competitions: Article: Competition And Cooperation On Sherman
Island: An Antitrust Ethnography “ Vol. 44 DePaul L.
Rev. 1225 (1995).
Bullard, Alfredo, “Dejar Competir o no Dejar Competir? He Ahi el Dilema, Las Practicas Predatorias y el Abuso de Posicion de Dominio,” Memorias, Aplicacion de la
Politica de Competencia, Superintendencia de Industria y
Comercio INDECOPI, Lima, Peru (1998).
Godek, Paul E., “A Chicago-school approach to antitrust for developing economies; Competition Policies for
Developing European Economies” $QWLWUXVW %XOOHWLQ
(March 1998).
Chakravarthy, S., “Role of Competition Policy in Economic Development and the Indian Experience” Paper
delivered to the Third Symposium on Competition Policy
and the Multilateral Trading System, Geneva (17 April
1999).
Gray, Clive S. and Anthony A. Davis, “Competition
Policy in Developing Countries Pursuing Structural
Adjustment, 7KH$QWLWUXVW%XOOHWLQ9ROXPH 38 (1993).
Khemani, R. Shyam, and Mark Dutz, “The Instruments
of Competition Policy and Their Relevance for Economic
Development” in Claudio R. Frischtak, 5HJXODWRU\3ROL
FLHVDQG5HIRUP$FRPSDUDWLYH3HUVSHFWLYH, (Washington: The World Bank, 1995) at 16.
Correa, Paulo, “La Abogacía de la Competencia en
Economías de Transicion: El Caso de Panama,” -RXUQDO
RI/DWLQ$PHULFDQ&RPSHWLWLRQ3ROLF\ Volume I, Special
Issue (December 1998).
Khemani, R.S., “International Merger Activity: Some
Concerns of Developing and Emerging Economies” in
Policy Directions for Global Merger Review A Special
Report by the Global Forum for Competition and Trade
Policy (1998).
Curiel, Claudia., “Los Procesos de Privatizacion Desde
La Optica de la Politica de Competencia: La Experiencia
en Venezuela 1993-1997. Trabajo preparado para el
Seminario Sobre Politicas de Competencia y Reforma
Economica, organizado por el Banco Mundial/OECD/
CADE/IBRAC; Rio de Janeiro, Brasil. 10 al 13 de Julio
de 1997.
Kovacic, William, “Competition Policy, Economic
Development, and the Transition to Free Markets in the
Third World: The Case of Zimbabwe”, $QWLWUXVW /DZ
-RXUQDO Volume 61 (1992).
De Araujo Jr., José Tavares, “Trade, Transparency and
Competition: FTAA and CER” -RXUQDORI/DWLQ$PHUL
FDQ&RPSHWLWLRQ3ROLF\ Vol. 1 Special Issue (1998).
Kovacic, William E. Cultural Conceptions Of Competition: Article: Designing And Implementing Competition
And Consumer Protection Reforms In Transitional
Economies: Perspectives From Mongolia, Nepal,
De Araujo, José Tavares, “Schumpeterian Competition
and its Policy Implications: The Latin American Case” A
paper prepared for the Second Meeting of the FLACSO/
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
Ukraine, And Zimbabwe Vol. 'H3DXO / 5HY 1197
(1995).
Kovacic, William, “Getting Started: Creating New
Competition Policy Institutions in Transition Economies,” %URRNO\Q -RXUQDO RI ,QWHUQDWLRQDO /DZ Vol. 24,
No.2 (1997).
Kovacic, William and Ben Slay, “Perilous Beginnings:
The Establishment of Antimonopoly and Consumer Protection Programs in the Republic of Georgia,” 7KH$QWL
WUXVW%XOOHWLQ (Spring 1998).
Kovacic, William E. and Ben Slay, “Perilous beginnings: the establishment of antimonopoly and consumer
protection programs in the Republic of Georgia; International Competition Policy” $QWLWUXVW %XOOHWLQ (March
1998).
Kovacic, William E., “Merger Enforcement In Transition: Antitrust Controls On Acquisitions In Emerging
Economies” Vol. 66 8&LQ/5HY 1075 (1998).
Mastalir, Roger, “Regulation of Competition in the
New Free Markets of Eastern Europe: A Comparative
Study of Antitrust Laws in Poland, Hungary, Czech and
Slovak Republics, and their Models, 1RUWK &DUROLQD
-RXUQDORI,QWHUQDWLRQDO/DZDQG&RPPHUFLDO5HJXODWLRQ
Volume 61 (1993).
McKoy, Derrick, “Antitrust Law in Jamaica: The Fair
Competition Act of 1993, -RXUQDORI7UDQVQDWLRQDO/DZ
DQG3ROLF\ Volume 5 (1995).
Musonda, M.J. “A Regional Competition Policy for
COMESA Countries and Implications of an FTA in
2000” A Paper Presented to the National Seminar on
Competition Law and Policy, Lusaka (May 31- June 2,
1999)
Neven, Damien; and Thomas von Ungern-Sternberg,
“Competition policy in Switzerland” $QWLWUXVW %XOOHWLQ
(June 1998).
Slay, Ben, and Vladimir Capelik, “Natural monopoly
regulation and competition policy in Russia; Competition
Policies for Developing European Economies” $QWLWUXVW
%XOOHWLQ (March 1998).
Song, Bing, “Competition Policy in a Transitional
Economy: The Case of China” Vol. 31 Stan. J Int’l L. 387
(1995).
Stevens, Dallal, Framing Competition Law Within an
Emerging Economy: The Case of Brazil, 7KH $QWLWUXVW
%XOOHWLQ Volume 40 (1995).
UNECA 7UDGHDQG&RPSHWLWLRQ3ROLF\LQWKH)UDPH
ZRUNRI$IULFDQ&RXQWULHV Working Paper Series, ECA/
ESPD/WTO/97/11 (December 1997).
UNCTAD :RUOG ,QYHVWPHQW 5HSRUW 7UDQVQD
WLRQDO &RUSRUDWLRQV 0DUNHW 6WUXFWXUH DQG &RPSHWLWLRQ
3ROLF\ (1997).
Vautier, Kerrin M. and Peter J. Lloyd, ,QWHUQDWLRQDO
7UDGHDQG&RPSHWLWLRQ3ROLF\&(5$3(&DQGWKH:72
(1997).
Van Miert, Karl, “Competition Policy in relation to the
Central and Eastern European Countries – Achievements
and Challenges” &RPSHWLWLRQ 3ROLF\ 1HZVOHWWHU (June
1998).
Vissi, Ferenc, “Challenges and Questions Around
Competition Policy: The Hungarian Experience,” )RUG
KDP,QWHUQDWLRQDO/DZ-RXUQDO Volume 18 (1995).
World Bank and OECD, $)UDPHZRUNIRUWKH'HVLJQ
DQG ,PSOHPHQWDWLRQ RI &RPSHWLWLRQ /DZ DQG 3ROLF\
(1999).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Synthesis Paper on the
Relationship of Trade and Competition Policy to Development and Economic growth” WT/WGTCP/W/80
(18 September 1998).
OECD &RPSHWLWLRQ3ROLF\LQD*OREDO(FRQRP\$Q
,QWHUSUHWLYH6XPPDU\ (1998).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
ASEAN,” WT/WGTCP/W/19 (3 July 1997).
Pittman, Russell, “Competition law in Central and
Eastern Europe: five years later; Competition Policies for
Developing European Economies” $QWLWUXVW %XOOHWLQ
(March 1998).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
ASEAN,” WT/WGTCP/W/33 (26 September 1997).
Rodriguez, A.E. and Malcolm B. Coate, “The Effectiveness of Proposed Antitrust Programs for Developing
Countries,” 1RUWK&DUROLQD-RXUQDORI,QWHUQDWLRQDO/DZ
DQG&RPPHUFLDO5HJXODWLRQ Volume 19 (1994).
Rodriguez, A.E. and Malcolm B. Coate, “Limits to Antitrust Policy for Reforming Economies,” +RXVWRQ-RXU
QDORI,QWHUQDWLRQDO/DZ Volume 18 No.2 (1996).
Schaub, Alexander, “EU Competition System—Proposals for Reform” 22 )RUGKDP,QW
O/- 853 (1999).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
APEC” WT/WGTCP/W/18 (4 July 1997).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from the
Czeck Republic” WT/WGTCP/W/71 (30 March 1998).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Hong Kong, China” WT/WGTCP/W/53 (4 December
1997).
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Hong Kong, China” WT/WGTCP/W/64 (6 March 1998).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Hungary” WT/WGTCP/W/27 (15 September 1997).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Kenya” WT/WGTCP/W/46 (25 November 1997).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Romania” WT/WGTCP/W/38 (1 October 1997).
WTO Working Group on the Interaction Between
Trade and Competition Policy, “Communication from
Singapore” WT/WGTCP/W/28 (15 September 1997).
Young, M. Kacou, “Politique de la Concurrence et
Coopération Internationale: La Perspective Africaine”
Paper delivered to the Troisième Colloque sur la Politique
de la Concurrence et le Système Commercial Multilatéral,
Geneve (17 Avril 1999).
6WDWHUHVSRQVLELOLW\
7UDGHDQGFRPSHWLWLRQSROLF\LQWKHIUDPHZRUNRI$IULFDQFRXQWULHV
%\'U&RUQHOLXV0ZDOZDQGD
Economic and Social Policy Division
Economic Commission for Africa (ECA)
Let me start first by thanking COMESA and the United
Nations Conference on Trade and Development
(UNCTAD) for inviting the Economic Commission for
Africa to, participate in this very important Conference
which is taking place at the turn of the new millennium.
Conferences, such as this one, offer a unique opportunity
to share views and ideas on challenges that face our continent in the context of the ongoing globalization and liberalization of the world economy. The topic of this Conference “Competition Policy, Regional Integration and
Development in COMESA” clearly reflects the challenges that many of our, countries face as they try to adapt
to the momentum of globalization of production and trade
and more importantly to the “competitive forces” of the
world economy.
for investments requiring large outlays. Furthermore,
governments may want to provide scope for flexibility in
implementation of Competition Policy laws in order to secure competitive advantage in international markets for
national industries of strategic interest.
Implementation of Competition Policy laws started in
earnest in the 1950s. Before then only the United States
had adopted the first Competition Policy laws in 1890.
However, since the early 1990s, a rapidly increasing
number of countries have passed CP laws. Nonetheless,
while competition policy is, an increasingly accepted concept at the international level, nations still have very
different levels of maturity in its development and implementation. National practices vary considerably according to the balance favoured by countries between public
interest and economic efficiency, the nature of their legal
systems, and their levels of economic and technological
development.
The globalization and liberalization of the world
economy has brought to the forefront the issues of fair
competition in international trade. The opening up of economics and markets to foreign direct investment and other
forms of participation by transnational corporations can
contribute directly towards contestability of host country
markets in that these markets can now be entered by firms
from other countries by establishing affiliates that produce goods and services within the host country and
thereby compete with domestic firms. Accordingly, the
liberalization of foreign direct investment regimes can
lead to contestability of national markets, as both domestic and foreign firms are obliged to compete at a level
playing field.
&RPSHWLWLRQSROLF\DQG ODZLQ$IULFD
African countries have made significant strides to liberalise their trade regimes, although much still needs to be
done in order for their economics to be effectively integrated into the global economy. The dilemma that continues to face these countries is how to respond to the inherent inequalities of the world trading system which
basically arise from an asymmetrical distribution of economic power between the developed and developing
countries.
7KHFRQFHSWRIFRPSHWLWLRQSROLF\
There is no common rule for the elements of competition law that a country should adopt and the different
competition laws that have been enacted by African countries generally reflect the objectives as well as the legal
traditions of the countries concerned. The “main objectives” of competition policy and law in Africa appear to
be similar and relate to: the need to organize and promote
free and fair markets; to promote economic efficiency; to
maximize consumer welfare; to encourage transparency
in trade practices. Furthermore, the main elements and focus of competition policy and law in African countries relate to: restrictive business practices; monopolies and
concentrations of economic power; mergers and takeovers; enforcement machinery; and extra-territorial coverage.
Competition policy is based on the idea that competition enhances economic efficiency. Composed of a set of
national rules, competition policy aims to prevent business from acting to the detriment of the common good by
reducing or eliminating competition as such practices can
reduce incentives for technical development and lead to
the impairment of investment and of quality of goods and
services. To ensure that this does not happen, competition
authorities investigate complaints arising from restrictive
business practices and enforce their findings through
legal action.
It is generally believed that competitive markets are
moreinnovative and efficient than those where industrial
power is too concentrated. However, it has also been observed that in some circumstances monopolies can better
improve welfare than competitive structures, for example
Several African countries have enacted and/or revised
laws governing competition policy and include Algeria,
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
Cameroon, Côte d’Ivoire, Gabon, Kenya, Morocco, Senegal, South Africa, Tunisia, Zambia and Zimbabwe.
Many of these countries have become relatively open
trade regimes and have introduced competition law and
established competition authorities to enforce the law. In
a number of other African countries, competition legislation is in preparation and includes Malawi, Ghana and
Egypt.
&RPSHWLWLRQSROLF\LQWKH6HDWWOH5RXQG
Whether Competition Policy (CP) should be included
in the next round of trade negotiations is the subject of debate in the preparatory process for the Seattle Ministerial
Conference. Those arguing for inclusion of Competition
Policy in the next round state that the absence of global
rules on enhancing competition sharply contrasts with the
global nature of business. In fact, an increasing number of
competition cases have important international components and the adoption of competition rules at multilateral
level could serve as a balancing factor to globalisation-related investment and mergers. Furthermore, competition
policy could contribute to overall objectives of the WTO,
including the promotion of trade. As trade and investment
liberalisation increasingly reduces entry barriers, the
competitive structure of markets becomes a more and
more relevant issue for market access concerns.
Whatever, the case, WTO members agree that setting
up an international authority on Competition Policy, with
its own powers of investigation and enforcement is an unfeasible option. Nonetheless, where countries stand on the
debate as to whether Competition Policy should be one of
the new issues in the WTO depends on: their appreciation
of the importance of the trade distortions provoked by the
limited co-operation at the international level; their opinion about the anticipated level of efficiency that such a set
of multilateral rules would achieve; the degree of flexibility that this common core of rules would provide for the
public interest element of CP; and their overall strategy
for the forthcoming trade negotiations.
3ULYDWL]DWLRQDQGFRPSHWLWLRQSROLF\LQ$IULFD
Privatization has been the central issue of the development agenda since the mid-1980s as several African
countries underwent structural adjustment programmes.
However, because of institutional and. limited savings capacity factors, local participation in privatizationhas been
significantly low. High political instability and economic
uncertainty has discouraged firms and households from
holding financial assets. Furthermore, many African
countries have been concerned that with privatization
large private corporations would replace existing public
enterprises, with no significant change in the monopolistic powers of such enterprises.
Accordingly, despite the expressed desire of many African governments to broaden ownership of indigenous
investors, with very few exceptions, methods that broaden local participation have not been commonly used.
Nevertheless, privatization has been on the rise and acceptance of the need to reduce the size of public enterprises has grown.
ECA has recently undertaken a study, which focuses
on review of the issue, the rationale and the problems associated with the broadening local participation in privatization including the difficulty encountered in reconciling equity with corporate governance within the African
context. Selective methods that broaden local participation are concisely discussed. These include management
and employee buyouts, employee share participation, directed group ownership, public flotation and financial
intermediaries. Moreover, because of the major linkage
between privatization and stock markets, a section of the
paper discusses the different stages and nature of development of African stock markets.
Country specific efforts and outcomes in broadening
local, participation are analysed. The countries and methods include Burkina Faso (consortium of local and foreign investors), Cape Verde (a participatory approach),
Kenya (a politically acceptable ownership), Uganda (directed group ownership), Zambia (privatization trust
fund), and Zimbabwe (Unit trust). Many of these schemes
for broadening local participation in privatization provide
very illuminating examples of efforts to ensure wider
ownership of privatized public assets. Broadening local
participation in privatization satisfies national aspirations.
Privatization that results in some private ownership by indigenous citizens appears to be more acceptable than outright sale to foreign investors.
Furthermore, some important lessons emerge from the
study. First, the study shows that in all the major
procedures in improving the process of privatization,
namely, securing consensus, ensuring transparency, investing more on design and preparation and ensuring appropriate institutional: blocks, the objective of broadening local participation reinforce the whole privatization
process. 6SHFLILFDOO\ EURDGHQLQJ ORFDO SDUWLFLSDWLRQ LQ
SULYDWL]DWLRQ VHFXUHV FRQVHQVXV RI WKH JHQHUDO SXEOLF
KHOSVWRGHSROLWLFL]HDQGVSHHGXSWKHSURFHVVLQGLFDWHVD
VWURQJFRPPLWPHQWWRWUDQVSDUHQF\DQGVHQGVDQHQFRXU
DJLQJVLJQDOWRIRUHLJQLQYHVWRUVSecond, acknowledging
the difficulty involved in designing and implementing
mass privatization, throughvoucherschemes in Africa in
the short term, the study points out that with a strong commitment and planning, it could be achieved at least in the
long-term. Third, as a prerequisite for promoting investment and acquiring credibility with both foreign and indigenous investors, continent-wide efforts are emphasized to ensure stability and to improve the investment
environment.
In conclusion, while the study builds on the fact that
privatization and stock market development are inextricably linked and mutually reinforcing it recommends this
only as a long-term solution to broaden ownership. It also
recommends the method of directed group ownership as
one of the ‘best practice’ to be implemented as a medium-term solution, concurrently with stock market development for an optimal path to broaden local participation in privatization of public assets.
)LQDO&RPPHQW
The challenges that face the global economy is how to
ensure that globalization and liberalization produce a
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
“Pareto optimal” situation in terms of increasing global
welfare. In such a situation promoting competition and a
“level playing field” in international production and trade
becomes imperative. Reducing restrictive business practices, ensuring that mergers and take-overs do not result in
undue concentration of economic power, and minimising
dumping practices are some of the objectives and targets
of competition policy.
Given the current stage of development of trade in Africa, the challenges of adopting an appropriate competition policy and law are indeed formidable because of the
dangers inherent in opening up economies, which hitherto
have been relatively closed. The need for African economies to be integrated in the world economy is no longer
an issue. However the pace at which this done, and the
economic and social costs associated with the process, is
an issue.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
3UDFWLFDOULVNVDQGRSSRUWXQLWLHVIRUFRXQWULHVFUHDWLQJ
QHZFRPSHWLWLRQODZVDQGHQIRUFHPHQWDJHQFLHV
%\'RQDOG,%DNHU
Attorney and Counsellor
Baker & Miller PLLC, Washington, D.C.
3. 0DNLQJWKH&RPSHWLWLRQ/DZWRRFRPSOLFDWHG²Vo
that it is hard for the Competition Agency to figure out
what to do, or for private parties to figure out which
among the many detailed provisions are likely to be enforced. It is also politically easier to hide special-interest
loopholes and exemptions in a complex statute.
I am honored to be here—and am very excited about
being in Africa for the first time in my life. We from
abroad have much to learn from you. I hope I have already
learned some of it—inside this room and outside it, too.
Your problems are not the same as our problems - or
Europe's either - and therefore you must be careful about
just following North American or European solutions in
competition law or elsewhere. (Last week in Bangkok,
Professor Bill Kovacic of George Washington University
old a wonderful story about a big U.S. law firm being paid
to draft a new competition law for an African country and the recipients were a little surprised to find buried in
their new statute a provision that said their new Competition Commission “shall have its headquarters in the
Mexico City Federal District.”)
4. 3URYLGLQJ WKH &RPSHWLWLRQ $JHQF\ ZLWK LQDG
HTXDWH WRROV IRU LQYHVWLJDWLRQ If the Agency lacks the
power to compel evidence—and to punish those who fail
to produce it—the Agency will not be able to effectively
investigate and prosecute a lot of the most important cases
especially cartel cases. (The civil law tradition is seriously
weaker on compulsory discovery than the common law
tradition.) The power to make unannounced searches for
documents (”dawn raids”) is particularly important where
other powers of compulsory production are not very
effective.
In creating your own solutions to your own circumstances, you still can and should learn from the mistakes
that others have made on North America, Europe, and
elsewhere. An old friend of a famous American Civil War
General said when the General died: “He never admitted
that he had made a mistake and he never repeated it.” (The
General was incidentally the brother of Senator John
Sherman for whom our first and most famous competition
law—the Sherman Act—was named.)
,
5. 8QGHUIXQGLQJWKH&RPSHWLWLRQ$JHQF\in relation
to its range of responsibilities. This is part of the “paper
tiger” problem: if highly visible competitive restraints
and abusive monopolies are not even seriously investigated, respect for the new Competition Law and enforcement
process will be weakened; and, if only a very few investigations are undertaken, the targets selected will argue that
they are being singled out for political reasons or favoritism of their competitors.
0LVWDNHVWREHDYRLGHGLISRVVLEOH
6. 5HTXLULQJWKDWWRRPXFKURXWLQHWUDVKEHVXEPLW
WHG WR WKH &RPSHWLWLRQ $JHQF\ for review or approval.
Compulsory filings will swamp the Agency staff and prevent them from investigating more important things.
(This is what the European Commission is admitting in its
recent White Paper on reform of the Article 85 notification system that now requires so many routine agreements
be reviewed by the Commission in order to be enforceable.) Compulsory filings are not a reasonable substitute
for adequate investigational powers and funding for the
Competition Agency, when it comes to uncovering serious violations.
Returningto the question of mistakes, let me list a few
that recur in OECD countries:
6WDUWLQJZLWK/HJLVODWLYH(UURUV
1. Creating a paper tiger—a nice sounding Competition Law that nobody is seriously enforcing. In practical
terms, nothing has really changed from the prior era. It is
simply “business as usual” for all concerned—the business community, the politicians, and the supposed enforcers. (This was true in the U.S. for the first decade or so after passage of the Sherman Act and may have been true of
the Canadian Combines Act for over half a century.)
7XUQLQJWR$JHQF\HUURUV
7. %HLQJUDQGRPDQGXQGLVFLSOLQHGLQVHOHFWLQJWDU
JHWV for investigation and/or prosecution. One variant
(which might be called the “mailbag problem”) occurs
when the Agency allows its enforcement agenda to be dictated by complaints. Stated simply, the Agency is likely to
lose stature and credibility if it comes to be perceived as
simply selecting cases on the basis of who complains and
2. 0DNLQJWKH&RPSHWLWLRQ/DZWRRYDJXH²so that
no businessman, lawyer or judge can predict what is legal
or illegal. Beware of terms like “unduly,” “unfair,” or “restrain,” if they are not explained in the statute or lack clear
meaning! (This was clearly true of the U.S. Sherman Act
and it took over two decades to get some YHU\basic concepts sorted out by the Supreme Court.)
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
how loud their voices are. The problem becomes even
worse if the complainants who have the most effective
voices are perceived to be special friends of powerful
politicians or their families.
8. %HLQJYDJXHLQH[SODLQLQJWKH&RPSHWLWLRQ$JHQ
F\
V HQIRUFHPHQW DJHQGD The purpose of rules, guidelines’, and even speeches is to give due warning to the
business community and their professional advisers as to
what conduct is likely to attract enforcement attention.
Once warned, many will choose to desist rather than risk
enforcement action. A serious test of the Agency’s success is how much voluntary compliance is achieved in
various areas of recurring business conduct. Cartel members are probably different: they generally know what
they are doing is illegal and tend to be deterred only by the
high probability of being caught and punished.
9. )DLOLQJWRIROORZWKURXJKRQ$JHQF\SURQRXQFH
PHQWV Once you say you are going to pursue certain types
of anticompetitive conduct or abuse, then you have to do
it. Otherwise, those who followed the Agency guidance
the last time are unlikely to do so again - and the pro-competitive benefits of the first pronouncement are diluted or
lost. (This is just another aspect of the “paper tiger” problem.)
10. )DLOLQJWRVHFXUHDGHTXDWHUHPHGLHVLQSDUWLFX
ODUFDVHV²be they fines, penalties, injunctive order or divestiture. It is nice to win a famous victory that law professors and Agency officials can lecture about - but it
matters little in the market if the business community does
not see Competition Agency victories LQODZ as achieving
victories LQIDFW. The Competition Agency temptation to
settle is strong - to save staff resources and avoid the risk
of losing—but, to get a good settlement, the Agency frequently has to be prepared to drag the defendant through
a long, painful legal process. This requires determination
and staff resources.
Having offered all these warnings, I still think that it is
a good idea for a COMESA Member State to have a Competition Law—provided that it is VLPSOH enough to be
ZRUNDEOHand enforcement is funded sufficiently to make
the law FUHGLEOHin the marketplace. Both simplicity and
credibility are important.
If these conditions are not met, it would be better to
have no law at all than to pretend you have a workable
law. (Even without a Competition Law, it is still possible,
as Mark Warner said yesterday, for competition policies
to be written into other regulatory laws for particular sectors, such as transportation or electric power.)
,,
3ROLWLFDO G\QDPLFV UHODWHG WR FRPSHWLWLRQ DQG
FRQVXPHUV
This gets me to the political dynamics that surround
competition law in most countries and how this relates to
trade law. The political reality of competition law is very
different from trade law.
Competition law is mostly about protecting FRQVXP
HUV²individualconsumers as well as enterprises that buy
intermediate goods and capital assets, and governments
that build highways and arm soldiers. Competition law
embodies a commitment to DSURFHVV²not any particular
RXWFRPHThe process seeks a market in which the efficient firms that respond to consumer demand can triumph
over the inefficient or unresponsive firms; it is a market
that allows consumers and suppliers to make the key
choices—free of covert conspiracies and monopolistic
bullying.
Trade law is mostly about protecting GRPHVWLFSURGXF
HUV who face loss of business to imports. Trade law is
about XQIDLU FRPSHWLWLRQ²anoften subjective concept—
that may be based on foreign government subsidies, price
discrimination, law wages or other special cost advantages. Trade law generally favors incumbents versus outsiders. It tends to be suspicious of innovators, price cutters
and other disrupters of the status quo. Some of what trade
law prohibits is clearly pro-competitive (e.g., dumping
that disrupts a domestic monopoly or oligopoly).
Competition works automatically and is generally invisible—so that the consumers who benefit from it do not
even know that the competitive market is providing the
critical incentives for lower prices and better services.
Consumers are notoriously poorly organized in most—
countries. There is simply no political constituency in favor of competition or competition law on an ongoing basis. The same is not true of the other side. Those who feel
threatened by competition are generally well organized
and politically determined not to give up the sweet fruits
from a monopoly tree. These well organized beneficiaries
may be producers, distributors, farmers, employees,
domestic monopolies, or less efficient service providers.
Because the champions of competition law are advocates for a PDUNHWSURFHVVthey differ from their opponents—who generally are advocates of SDUWLFXODU UHVXOWV
(such as maintaining particular jobs and firms, barring
new entrants, or preserving special cross-subsidies embedded in monopoly rates). Frequently, those who oppose
competition opponents have as an ally some key bureaucracy—a Ministry of Finance, or Commerce, or Agriculture, or Transportation – which shares their commitment
to stability and other non-competitive outcomes.
All this can lead to a serious risk of a GHYLO
VEDUJDLQ
when a new Competition Law is proposed:
• The champions of competition (the economists, the
populists, and the World Bank/IMF, etc.) are rewarded with enactment of an impressive sounding
Competition Law.
• Meanwhile, key opponents of competition are given
sectoral loopholes and exemptions that save them
out from the general Competition Act rules; and they
may also receive quiet assurance that the Competition Agency will be kept too small and weak to be a
serious threat to most enterprises.
Thus the competition champions can shout to the public “we have won- a famous victory. Now we too have a
competition law and a competition agency in our country.” Meanwhile, the opponents can PXWWHU TXLHWO\²
“wellwe dodged that crazy bullet.” (In fact, in the United
States, when Congress enacted the famous Sherman Act
in 1890, it also passed a Tariff Act that raised import
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
duties to new heights, while providing no special appropriation for antitrust enforcement.)
,,,
$QDIILUPDWLYHFRPSHWLWLRQDJHQF\DJHQGD
Let us assume political success rather than failure at
the legislation stage—and ask what the new Competition
Agency should do if given reasonable tools and resources.
It should think carefully and big. There are two important
roles:
(1) The traditional role of HQIRUFLQJ the FRPSHWLWLRQ
ODZE\LQYHVWLJDWLRQVGHFLVLRQVDQGFDVHVand
(2) The less-defined role of acting as DGYRFDWH IRU
FRPSHWLWLRQwithin the government.
The two are related: what the Competition Agency
learns in investigating a suspected restraint or monopoly
a case may be used to advocate a broader policy before the
Parliament or Cabinet, or a government committee or
regulatory agency.
$
7UDGLWLRQDOLQYHVWLJDWLRQVRIVXVSHFWHGOHJDO
YLRODWLRQV
Here priority—in terms of resources and effort—
should be give to:
• Investigation and prosecution of ORFDOFDUWHODFWLYLW\
²includingprice fixing, bid rigging, market allocation agreements among competitors.
• Investigating DEXVLYHPRQRSRO\FRQGXFW.
The Competition Agency need not (and should not)
just confine itself to “big” or “national” cases. I believe
that price fixes, bid rigs, and customer allocations are
much more prevalent than some may assume. Local
banks, local service companies, or local merchants often
agree on price floors or agree not to peach each other's
customers.
3ULFHIL[LQJconspiracies are hard to discover and prosecute. Thus it is important to try create incentives for
those who know about a conspiracy or have participated
in it to “blow the whistle” on everyone else involved.
There are several possible tools:
²$PQHVW\, LPPXQLW\ or SHQDOW\ UHGXFWLRQtoinformants in return for evidence (these devices are used in
North America and Europe).
²%RXQWLHVfor whistleblowers (we use this device in
the U. S. to deal with fraud on government contracts,
but not in antitrust investigations).
²,QWUXVLYHLQYHVWLJDWLRQ²dawn raids, etc. to encourage participants to believe that they might be caught
and therefore had better cooperate.
1
I tried to outline the U.S. approach to traditional competition law
investigation and enforcement in a paper at a 1993 European Institute
conference at Leiden in the Netherlands. See “Investigation and Proof
of an Antitrust Violation in the United States: A Comparative Look”, in
P.G. Slot and A. McDonnell (eds.), Procedure and Enforcement in E.C.
and U.S. Competition Law (Sweet & Maxwell 1993).
0RQRSROLVWVpresent a different problem. They are generally clear, notorious, and have every incentive to drag
out any Competition Law enforcement proceeding. At
times, it may be more effective for the Competition Agency to try to open up the monopolized local market to imports—rather than to battle the monopoly in an endless
proceeding. In any event, “abuse of monopoly” proceedings tend to be resource intensive, because the evidence
on conduct is frequently ambiguous and it is necessary to
separate HIILFLHQW monopoly conduct from DEXVLYH monopoly conduct. The Competition Agency should not
want to punish “skill, foresight and industry” which has
enabled a firm to become dominant - even if the firm
thereby makes life miserable for its competitors in the
market. (Opening up the domestic market to imports is
still an appropriate goal policy even with an HIILFLHQW
QRQDEXVLYHdomestic monopolist.)
0HUJHUHQIRUFHPHQWis another increasingly common
area of competition law, but it can be resource intensive
and disruptive of other enforcement efforts because of
short time deadlines and high visibility. No country
should just embark on merger enforcement because lots
of other countries are doing so. Any merger enforcement
program for a new Competition Agency should probably
be limited to horizontal mergers in concentrated markets
and should only be undertaken if adequate staff is available.2 Very limited and random merger enforcement is
likely to look politically motivated. “Why did they try to
block our merger when they let so many others go in even
more concentrated markets?” is an easy question to ask
and may sometimes be a hard one for the Competition
Agency to answer. Merger enforcement based on vague
ideas of Industrial policy” seems an affirmatively bad
idea. I believe that Competition Agency enforcement
guidelines are particularly useful in the merger area (and
this is supported by experience in the United States and
Canada). So are public explanations of decision not to
block particular mergers (as in the EU).
% $GYRFDF\RIFRPSHWLWLRQSROLFLHV
There is a serious difference in mission and policy between (1) a Competition Agency on one hand and (2) sector-specific regulators or constituency-promoting ministries (“the Regulators”) on the other. The Competition
Agency's task, broadly speaking, is to protect the interests
of FRQVXPHUVand HIILFLHQWSURGXFHUVin an effective market system. The Regulators frequently focus on particular
enterprises or interest groups whose interests may seem
threatened by competition HJcommon carriers, farmers, employees, or domestic manufacturers). The tension
is particularly clear in the international trade area—with
antidumping regulations being classic producer-protection regulation that often runs counter to competition
policy when it causes consumers to pay higher prices or
be offered fewer goods than would otherwise be the case.
2
See D. Baker “Antitrust Merger Review in an Era of Cross-Border
Transaction and Effects” (at pp. 71-78) and R.S. Khemany “International Merger Activity: Some Concerns of Emerging and Developing
Economics” (at pp. 103-108) in Policy Direction for Global Merger
Review (Global Forum for Competition and Trade Policy 1999).
3
A good current example is found in A. Gunderson, J. Montiero,
and G.C. Robertson, “Competition Bureau Advocacy in the Canadian
Telecoms Sector” (Global Competition Review June/July, 1999).
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
Even in the context of an industry-specific or interest
group-driven regulatory scheme (such as antidumping),
there is substantial room for the Competition Agency to
cause competition policy to be given a much wider role
than the Regulators’ traditional constituents would prefer.
This can sometimes be done by legal proceedings, or internal advocacy within the government, or public lobbying for legislative reform.
4. Can the Competition Agency file antitrust VXLWV LQ
GHSHQGHQWO\ against anticompetitive conduct approved, encouraged or tolerated by the regulator (as
is true, e.g., in the banking and electric power sectors in the U.S.)?
Where the Competition Agency has limited staff resources (as is true in most countries), effective advocacy
of pro-competition decision-making by the government
may pay bigger dividends for consumers than many classic antitrust investigations.4 The two types of effort clearly can be made to be complementary (as when an antitrust
investigation leads to insights and evidence that the Competition Agency can use in promoting a better general
policy).
It seems altogether appropriate for the Competition
Agency to try to get some of these powers whenever a political opportunity to do so comes along. When a national
parliament is creating a new Competition Agency may be
a more opportune time to do so, than later when the Competition Agency has already made itself a nuisance to
some politically-important interest groups and Regulators.
Challenging well-established Regulators or protected
interest groups can involve serious political risks forthe
Competition Agency. Therefore, careful selection of targets, tactics, and timing is critical. Possibly relevant
opportunities include:
,9.
1. 7UDGH ODZ enforcement proceedings where the domestic monopolists or oligopolists are treating
themselves very well at the consumers’expense.
2. 3ULYDWL]DWLRQ of a state monopoly where competition would clearly work in the market.
3 5HJXODWLRQ RI a PRQRSRO\ by a sector-specific
Regulator which is thwarting entry, maintaining a
cartel, or preventing disruptive innovations.
4. /LFHQVLQJSURFHHGLQJVthat are likely to result in an
award of a monopoly franchise to an already
dominant and visible competitor.
Any of these may result in a political battle royal within the government. How successful the Competition
Agency is may depend on how strong its legal tools are:
1. Does the Competition Agency have the IRUPDOULJKW
WR LQWHUYHQHasin Canadian trade proceedings)?
2. Does the Competition Agency have the right to
IRUFH the Regulators to hold a hearing on anticompetitive practices before it can grant a license or approve a transaction (as in the nuclear licensing system in the U.S.)?
3. Does Competition Agency have ULJKWWRDSSHDOand
adverse decision by a Regulator (as is sometimes
true in the United States, producing cases with such
amusing names as 8QLWHG6WDWHVv,QWHUVWDWH&RP
PHUFH&RPPLVVLRQor even 8QLWHG6WDWHVv8QLWHG
6WDWHV"
4
We had some particularly favorable U.S. experience in the 1970s
—when public frustration with inflation and effective advocacy by the
Antitrust Division of the Justice Department helped to produce some
enormous competitive results. These included airline and trucking deregulation, the elimination of cartel commission rates on the stock exchanges, and ultimately the break-up of the telephone monopoly. (The
Antitrust Division, however, proved less effective when it tried to intervene in antidumping cases.)
5. Can the Competition Agency YHWRa Regulator's decision (as under the U.S. privatization statute)?
7KHILQDOTXHVWLRQVLVDUHJLRQDOVROXWLRQEHWWHU"
6KRXOG&20(6$FRQVLGHUHVWDEOLVKLQJDFRP
SHWLWLRQODZRUDJHQF\"
This is a tough set of issues. Elevating competition law
enforcement to the regional level does not make politics
go away—indeed, it may make the problem worse. Still,
even if the Member States can agree on strong and clear
Competition Law provisions, then it may well be a good
idea. (The European Community clearly offers an outstanding example of regional competition enforcement
that is more effective than that of most individual states in
the regional group.)
Having a separate COMESA competition law would
not necessarily require a special COMESA enforcement
agency. So long as leading COMESA members have
Competition Agencies that can cooperate, these could enforce both their own national laws and the COMESA law
as well.5 The members could still rely on the COMESA
court to bring some reasonable level of harmonization in
how the COMESA law was interpreted.
It would probably be even more important to have a
JRRGFRRSHUDWLRQDJUHHPHQWamong national authorities
than to create a new COMESA Competition Agency at
this early stage. Such an agreement would allow the national agencies to exchange fruits of investigations, and
use them in domestic proceedings, either under the
COMESA law or the Member State law—than try to create a COMESA agency.
It would be an affirmatively bad idea to try to create a
COMESA Competition Agency unless it would be a
strong one politically. It has to be strong enough to battle
effectively with the sector Regulators or governments in
the Member States. (Europe shows how hard this is even
for a strong Competition Agency.)
I recognize that smaller members might prefer to have
a single Competition Law and Competition Agency at the
5
In the U.S., we allow the State Attorneys General to enforce the
Federal Antitrust Laws as well as their own state antitrust laws. See,
e.g., Hartford Fire Ins. Co. v. California, 509 U.S. 764 (1993) (state proceeding against domestic and foreign defendants based only on
Sherman Act).
5HJLRQDO6HPLQDURQ&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQW
COMESA level (rather than for each to have a very small
national agency). On the other hand, larger members
might regard a proposed COMESA Competition Agency
as a potential hassle—and therefore oppose the idea or at
least assure that the COMESA Competition Agency is
kept weak and understaffed.
ly staffed—if it really were to deter would-be cartel participants and monopolists in the region.
If I am wrong—and larger Member States would seriously support this regional approach—then creating a
COMESA Competition Agency would be a possible
course. It could be more efficient, and could bring cases
in national courts. But such the “paper tiger” problem
does not go away at the regional level. A COMESA Competition Agency would have to be strong—and adequate-
Those of you sitting around this room are embarked on
a difficult and important task—of crating competition
laws and agencies that UHDOO\ZRUNin environments where
the idea of FRPSHWLWLRQHQIRUFHGE\ODZmay seem strange
and disruptive to a lot of traditional interests. You deserve
not only our technical assistance—but our warm support—as you go forward.
9
&RQFOXVLRQ
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
% &21&/86,216$1'5(&200(1'$7,216
,
&RQFOXVLRQV
7KHLQWHUUHODWLRQVKLSEHWZHHQWKHREMHFWLYHVLQVWUX
PHQWVRIWUDGHLQYHVWPHQWDQGFRPSHWLWLRQSROLFLHV
5HOHYDQFHRIFRPSHWLWLRQSROLF\SULQFLSOHVVFRSH
DQGLQVWUXPHQWVWRUHJLRQDOLQWHJUDWLRQ
DQGGHYHORSPHQWLQ&20(6$
The group agreed:
(D) That the conduct of enterprises and associations on
trade can be detrimental to the flow of goods and services
particularly through international cartels, abuse of market
dominance, certain price-discrimination etc.
The Group agreed that:
(D) Competition law and policy is an essential component of the policy measures required for the success of
economic reforms and trade liberalisation process put in
place by COMESA member States.
(E) That State monopolies and exclusive rights can affect market access and be harmful to the proper functioning of markets.
(E) Competition law and policy should be clear, transport and enforced effectively in a transport and non-discriminatory manner.
(F) That regional trade integration measures should be
consistent with overall trade liberalisation commitments
of member countries. In this context coherent national
competition policies should be pursued.
(F) Competition authorities should be autonomous and
adopt a flexible approach to the enforcement of the law,
and should also be a policy advocate and catalyst in creating a “competitive culture” and keep a check and balance
on government policies, regulatory agency decisions and
privatisation.
(G) The growing flow of Foreign Direct Investment
provides developing countries with opportunities to integrate their economies into the world economy and expand
their economic base. To this end, it was agreed that competition policy is Primus inter pares among other policy
measures (Trade and Investment policies) that could
maximise the benefits of such flows.
(G) The design of appropriate competition policy as
well as subscribing its areas of applications to meet development objectives need to be flexible and effectively
implemented.
,,
7KHUROHRIFRRSHUDWLRQDQGFRPPXQLFDWLRQLQ
FRPSHWLWLRQODZDQGSROLF\:KDWFDQEHDFKLHYHG
DWWKHUHJLRQDODQGLQWHUQDWLRQDOOHYHO
5HFRPPHQGDWLRQV
(1) The Seminar recognised that Article 55 of the
COMESA Treaty provides an advanced regional policy
on competition, which should be sued as a starting point
for further developing the regional competition policy.
The group agreed:
(2) The Seminar concluded that this regional Seminar was timely and effective in addressing the issues of
competition policy and regional integration within
COMESA. The group having reviewed the terms of reference for the study on COMESA Competition Policy,
made a number of recommendation for refocusing its objectives and scope which were incorporated in the text
(see Annex). The group called upon UNCTAD to continue to extend its technical and financial support to COMESA member States in formulating and enforcing national
competition laws. It also called upon UNCTAD to assist
the COMESA Secretariat in carrying out the Study on
Competition Policy.
(D) There is need for strong and effective cooperation
among competition agencies in the exchange, of experiences and expertise as well as non-sensitive information
and enforcement including positive and negative comity.
(E) Cooperation between competition and regulatory
agencies in various sectors along the lines of the reference
paper on telecommunications.
(F) COMESA members should study the implications
of the current proposals for international cooperation in
the area of competition policy including the EU proposal,
the OECD and UNCTAD on the development dimention
and regional integration efforts.
(3) COMESA should as much as possible develop an
institutional framework for the regional competition policy within the existing framework. In this respect the existing COMESA Court of Justice and the national Courts
could be linchpins for giving legal interpretation to the
“purpose” and “intention” of Article 55.
(G) The regional cooperation objectives and aims of
COMESA should be realistic and appropriate to the needs
of its member countries.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
3$57 ,,
1$7,21$/ 6(0,1$5 21
&203(7,7,21 /$: $1' 32/,&<
3DSHUVSUHVHQWHGDWWKH1DWLRQDO=DPELDQ6HPLQDU
/XVDND=DPELD0D\±-XQH
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
$
68%67$17,9(&2175,%87,216
7KHUROHRIFRPSHWLWLRQODZDQGSROLF\LQGHYHORSPHQW
WKHH[SHULHQFHRI=DPELD
%\1LFKRODV.ZHQGDNZHQD
&KDLUPDQRI=DPELD&RPSHWLWLRQ&RPPLVVLRQ
Allow me to welcome all our foreign and local guests
participating as speakers and as audience in order to share
our pride to organize the first national and regional seminar in Zambia in the field of Competition Law and Policy.
ment where economic activity is already highly concentrated, mainly due to past government policies and
interventions. These laws are now seen as instruments to
accelerate the transformation process where economic activity is primarily determined by private ownership and
market forces instead of state ownership and controls. Although, during the past 100 years, the role and importance
of competition law has varied across countries and overtime, it has evolved as not only being an instrument to
prevent anti-competitive business practices, but also to
pro-actively strengthen market forces.
The purpose of this National seminar is basically to
foster the development of competition expertise outside
the Zambia Competition Commission. Consequently,
present amongst us today are the leading experts from the
legal, educational, business and government departments.
It is my sincere hope that after the two days of intense
discussions on the economic foundations of competition
law, you will be able to participate effectively at the Regional seminar which commences on Wednesday, 3 June
1999. The Regional seminar will offer you a unique forum for exchange of ideas and cross-fertilization on the issues pertaining to the implementation and enforcement of
Competition Law and Policy by the respective COMESA
countries. I hope all of us shall not miss this great regional
debate on Competition Law and Policy.
It is now a fact that the period since 1991 has witnessed
an unprecedented process of economic and social transformation in Zambia. The central theme of this process
has been the switch from the system of central planning or
control of the economy to the use of market forces as the
means to allocate resources. It was anticipated that the
“free play” of supply and demand would, in the long run,
determine market prices throughout the economy, allowing productive resources to be allocated in an efficient
manner. Structural adjustment programs were adopted
that included market oriented reforms notably in the areas
of deregulation of prices, including the reduction or
elimination of subsidies, administrative allocation of key
product inputs, privatization of public enterprises or state
companies, as well as the liberalization of trade policy
and investment regimes.
7KHJURZLQJHPSKDVLVRQFRPSHWLWLRQODZ
Towards the end of the last century, the first set of
competition (antitrust) laws were enacted among the
western industrialized countries, namely by Canada
(1889) and the United States (1890). It is interesting to observe that 100 years later, several developing and transition market economies are now embracing competition
laws. Since 1990 alone, more than thirty-five such countries have adopted new or have substantially revised their
existing competition laws including virtually all of the
former communist centrally planned economies in Central and Eastern Europe, and the former Soviet Union.
The common aspiration underlying these reforms has
been that the reduction of government's direct involvement or intervention in economic activity would, by providing enterprises with more freedom and stronger incentives, stimulate entrepreneurial activity, business
efficiency, productive investment and economic growth,
as well as enhance consumer welfare through improved
quantity and quality of goods and services at prices determined by the market rather than administrative decision.
Several other countries more especially in the
COMESA/SADC region are in the process of following
suit. However, the underlying basis for the renewed interest in competition law differs from that a hundred years
ago. The concerns during the end of the last century centered around preventing increased levels of industry and
aggregate concentration which could give rise to the exercise of “market power” and undue economic-political influence. The competition laws were passed during a period of unprecedented corporate merger and acquisition
activity, consolidations and formation of “trust”.
However, it was also recognized that the benefits of
market oriented reforms are likely to be fully realized
only if enterprises acted under the spur of competition, so
that consumer wishes and opinions are reflected in market
performance. It was further recognized that, a country that
has undertaken trade liberalization measures has every interest in ensuring that the welfare and efficiency benefits
arising from such measures are not lost due to anti-competitive practices by firms. A well functioning market
mechanism is essential in this respect. For example, price
liberalization in the market dominated by monopolies in
In contrast, competition laws in developing and transition market countries are being adopted in an environ
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
form of parastatal companies, unless specific efforts are
made to ensure the existence of competition, will end up
in monopolistic price rises without corresponding competitive price equilibrium.
In recognition of the major role of competition law and
policy for the success of the policy reforms, the government enacted the Competition and Fair Trading Act of
1994. The act has generally two principal aims:
i(i) To prevent anti-competitive conduct thereby encouraging competition and efficiency in business,
resulting in greater choice for consumers in price,
quality and service; and
(ii) To ensure the interests and welfare of consumers
are adequately protected in their dealings with
producers and sellers.
nity. The existence of a “competition culture” within the
country is vital to the success of the Commission's work
and ultimately to the effectiveness of the competition law.
It is important to bear in mind that the competition enforcement can only be more effective if there exists outside the Commission a community whose members
understand and support the concept of competition. Very
few of us up to now understand what competition law and
policy is all about. It is in this regard, that the first task of
the Commission this year was to promote competition
policy. There are several ways of achieving this, but it
may include the following:
—Providing as much information as possible to the
public about the activities of the Zambia Competition Commission;
—Educating the consumer and the business communities about the law such as, the meaning and
purpose of its provisions and the procedures
through which the law is enforced;
Although the Competition and Fair Trading Act was
enacted in 1994, the act only came into force in February
1995. The Zambia Competition Commission was established later in April 1997. It is evident that the Commission was supposed to have commenced its operations at
the same time as the Zambia privatization agency commenced its operations. Unfortunately this was not the
case. However, the problems of competition were foreseen during the enactment of the privatization act. The act
clearly specifies that during the privatization of state
owned companies, the privatization agency shall ensure
that monopolies are not created in the process of privatization. It was realized during the privatization process
that if the sale of state owned enterprises was not carefully
planned, the whole privatization process may end up
transforming the state monopoly into a private “hardcore” monopoly.
I am informed that the topics to be covered during both
the National and Regional seminars will cover or attempt
to answer several pertinent questions relating to Competition Law and Policy such as:-
The existence of an effective competition policy ensures that industries which are privatized or deregulated
cannot re-organize themselves as private monopolies.
—Do countries need a specific competition law to
complete their national economic development
policy framework?
Until the enactment of the competition law, there has
been no formal enforcement of competition rules and
policy by any institution in Zambia. Consequently, the
creation of the Zambia Competition Commission is the
first attempt by the government to enforce the competition rules in various ways and it is hoped that it will eventually lead to their uniform interpretation and application,
in view of the different attitudes towards competition
rules by the business community.
—Are other policies that promote competition, such
as liberalization of international trade, privatization and regulation not sufficient?
The objective of the Zambia Competition Commission
is primarily to establish conditions of free and effective
competition in the economy, to ensure that the anti-competitive practices do not create barriers to trade or other
forms of protectionism. The competition rules set down
minimum standards and allow enterprises to penetrate
markets and establish themselves thereby facilitating
inter-market trade.
Although an effective competition law is important, it
is also important to foster a “culture of competition” in the
economy. In this regard, the Zambia Competition Commission faces a formidable but highly important task in
building awareness and support for competition policy
among the general public and within the business commu-
—Developing public support for enforcement, by
demonstrating how consumers and the country at
large benefit from an effective competition policy; and
—Fostering the development of competition expertise outside the Zambia Competition Commission
i.e. to legal, educational, business and government communities.
—Is enacting of competition law not a low priority,
worth considering only after other more urgent
policy measures have been introduced?
Finally, I want to assure you that the Commission will
work together with you as users of the system, in establishing broad principles of competition that are designed
to preserve an unrestrained interaction of competitive
forces that will yield the best allocation of resources, the
lowest prices and the highest quality products and services for consumers.
I wish to urge you to discuss the Competition Policy
matters and make a significant contribution to the success
of the joint ZCC/UNCTAD/COMESA regional seminar
on the theme Competition Policy, Trade and Development, which takes place later this week starting on 3 June
to 4 June, 1999.
It is now my rare honour and privilege to officially
open this national seminar on Competition Law and
Policy.
7KH GHYHORSPHQW RI FRPSHWLWLRQ ODZ DQG SROLF\ LQ =DPELD
%\0U*HRUJH./LSLPLOH
Executive Director
Zambia Competition Commission (ZCC)
The implementation of Competition Policy continues
to be not an easy matter in the majority of developing
countries. My presentation will limit itself to Southern
Africa, particularly the countries constituting the Common Market for Eastern and Southern Africa (COMESA).
The countries in this region had not gone very far down
the competition policy path, thinking it was either unnecessary or unimportant when the main suppliers of goods
and services in non-competing markets were in the public
sector and therefore under government. There was no significant private sector to talk about. The general structure
of the markets in these countries were characterised by a
high concentration of economic power in state owned enterprises. In fact, certain government policies in some of
these countries at the time encouraged monopolies by
granting exclusive rights to specific state enterprises to be
the sole producers in specific sub sectors of industries. In
addition, there still existed various pieces of legislation
which provided for arbitrary intervention of government
in markets, and in some cases limit or control the entry
into certain markets.
and Malawi. Both these countries have recently enacted
legislation on competition law and policy. They have recently called for Technical Assistance from UNCTAD to
have Competition Authorities established in their respective countries. The other countries which are set to establish a Competition Authority are likely to be Botswana,
Namibia and Ethiopia.
From the above, it is clearly evident that the list of
countries in the region which now have Competition
Authorities is growing. These trends underline the increasing importance of Competition law and policy as a
means to ensure the efficient allocation of resources in an
economy, resulting in he lowest prices and adequate supplies for customers. At the regional level, too, competition
policy is gaining increasing attention. There are already
requests from member states leading to the establishment
of a harmonised competition regime in the Southern African states under the auspices of COMESA. Apparently,
the COMESA Agreement has a provision on the competition policy which calls for all member states “to prohibit
any agreement between undertakings or concerted practice which has as its objective or effect the prevention, restriction or distortion of competition within the common
market”. However, the treaty exempts the application of
this provision to any agreement, decision or concerted
practice which improves production or distribution of
goods or promotes technical or economic progress and
has the effect of enabling consumers a fair share of the
benefits. Unfortunately for the region, no concrete effort
has been made as yet by the organisation to promote or
implement the competition policy in its member states. It
may be now imperative for the organisation or its members states to come up with an administrative machinery
to implement and enforce competition policy at regional
level. At international level, we should not lose track of
our legal obligations under the World Trade Organization
(WHO) Treaty. We are still required under this treaty to
enhance the competitive process in our national economies.
The economic scenario in these countries began to
change in the last decade. The need for developing a comprehensive competition law and policy was as a result of
economic changes in the whole region. With the majority
of developing countries abandoning socialist oriented
economic principles, most countries chose to pursue Practices (RBPs)as well as work on the model law on Restrictive Business Practices facilitated the enactment of competition legislation in these countries.
The importance attached to Competition law and policy in the region varies from country to country. South Africa has just finished major amendments to its competition law aimed at enhancing the operations of the national
Competition Authority. Kenya introduced the national
Competition Authority immediately it abandoned its price
control system about nine years ago.
They are now carrying out a review of their competition legislation to give more powers to the Authority and
make it autonomous. Tanzania, I am informed, has already a competition legislation in place. However, the impact of the law continues not to be felt by industries as its
administration has been left with a government division in
the Ministry of Trade and Industry. There may be need to
revisit the law and make its enforcement more effective.
Mauritius and Madagascar with the technical assistance
of UNCTAD has already passed legislation on Competition Law. It is more interesting in the case of Zimbabwe
From the foregoing, it can also be argued that countries
in this region are still reluctant to accept the need to promote and implement the competition policy in their development strategies. There is an argument to the effect that
those countries which have progressed to establish Competition Authorities appear, more importantly, to be doing
so because it is one of the conditions laid down by the
IMF and the World Bank if they have to get financial support. Otherwise there appears to be no full conviction on
the part of government policy makers, business commu
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
nities and trade associations in these countries on the
establishment of Competition Authorities.
Alternatively, the delay might be due to lack of the financial resources required to establish and enforce the
competition law. Most developing countries have their
priority in encouraging productive sectors and agriculture
capacities. The establishment of Competition Authorities
is not as yet on the priority list. It is not my wish to comment any more on this argument as it is highly debatable
and it cannot be easily applied to all the countries in the
region.
7KH=DPELDVHWWLQJ
Until recently, Zambia has been in a similar position to
many other developing countries in the region. About
80% of the Industrial, transport and energy companies
were in the public sector and their policies were strictly
controlled by government, often with social objectives in
mind.
The so called private sector at the time was very small
and there were hardly any large companies in what was
deemed the private sector. The parastatal sector under
ZIMCO was mistakably considered as the private sector.
A competition policy at the time was obviously not appropriate, as Zambia was not a market economy and in any
case, the likelihood of significant anti competitive behaviour or practices in the private sector was low.
The advent of economic and political liberalisation in
Zambia dating from 1991, witnessed the adoption of
structural adjustment programs involving the introduction
of market oriented reforms. The central theme of this
process or reforms has been the move from the system of
central planning to the use of markets as the means to promote economic efficiency. Thus, The necessary conditions in the markets were created that made a competition
policy a useful economic instrument.
The liberalisation process which the country embarked
on led to the rapid enactment of new laws and amendments of existing laws, especially in the field of business
and commercial related laws. This was in certain circumstances accompanied by the establishment of new institutions to implement the newly enacted laws.
7KH=DPELDFRPSHWLWLRQ
I will now look briefly at the competition legislation in
Zambia by illustrating its main features. The Competition
and Fair Trading Act came into force in February, 1995.
The Act was enacted in May 1994. The principal aims of
the Act are:
—To secure the best possible conditions for the
freedom of trade; and to expand the base of entrepreneurship.
6FRSHRIWKH$FW
The Act applies to all enterprises in relation to all their
commercial transactions regarding the supply of goods
and services. The Act does not apply to certain activities.
There are explicit exemptions which are specified under
the Act. The notable one being that the Act shall not apply
to any activity i.e. a treaty or agreement to which the state
is a party. It would appear the provision is meant to allow
government not to be bogged down during its negotiations as a result of the requirements under the competition
law. The other areas exempted from the application of the
Act are:
—Activities of employees for their own reasonable
protection as employees;
—Arrangements for collective bargaining on behalf
of employees for the purpose of fixing terms and
conditions of employment;
—Agreements relating to the use of Intellectual
Property rights;
—Such business or activity as the Minister may, by
statutory instrument, specify.
7KHPDLQHOHPHQWVRIFRPSHWLWLRQSROLF\
Ladies and Gentlemen, allow me now to briefly outline
an overview of the main elements of competition law as
they are found in the Act, while also reflecting on the economic significance of these provisions.
The main elements of the Competition and Fair Trading Act generally cover the potential restrictions on competition relating to horizontal restraints, vertical restraints, abuses of dominant position and merger review
control. The Act as earlier stated defines anticompetitive
trade practices as any agreements, decisions and concerted practices which have their object the prevention, restriction or distortion of competition to an appreciable extent in Zambia or any substantial part of it. These are
prohibited. The four main elements of competition law as
provided for under the Act are:—Mergers/takeovers;
—Horizontal agreements;
—Vertical market restraints; and
—Abuse of dominant position.
—To encourage competition in the economy by
prohibiting anti-competitive trade practices;
I will not dwell much on these concepts as they are going to be ably covered by my colleagues from UNCTAD,
Mr. Qaqaya and Mr. Dhanjee after the coffee break. Consequently, I will be extremely brief. However, I will dwell
a bit longer on the merger/takeover regulation.
—To regulate monopolies and concentrations of
economic power; to protect consumer welfare;
0HUJHUV
—To strengthen the efficiency of productions and
distribution of goods and services;
The merger regulation is an important element of any
law aiming to preserve levels of competition. Mergers can
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
lessen competition, potentially providing increased scope
for price rises or collusive behaviour and lessening dynamic factors such as the rate of innovation. These possible detriments provide the rationale for government intervention in the area of mergers or takeovers.
In considering whether to grant authorisation to a proposed merger, takeover or any other form of acquisition,
the Commission’s main concern will be to ensure that the
merger or takeover will not result in a substantial lessening of competition in any market in Zambia or a substantial part of it. However, mergers may be one means of
achieving efficiencies, particularly where increased exposure to global markets is placing pressure on domestic
firms to reduce costs, improve quality and service and innovate in order to become more competitive in those markets. Efficiency issues are relevant both for assessing the
impact of a merger on competition and for assessing the
overall public benefit that would flow from a merger.
Further, when considering a proposed merger or takeover, the Commission will usually. approach it on the basis of a consultative process with the parties and the relevant industry, in order to determine the potential market
place effect of the merger. In most cases it will not be an
adversarial process but one of consultation as no offence
has been committed and parties will often seek the Commission’s informal opinion well before proceeding with a
merger or takeover proposal.
The Commission normally evaluate proposed mergers,
takeovers and acquisitions in two circumstances, namely:
ii(i) Where it is believed that the object of the merger
or acquisition is to prevent, restrict or distort
competition; or
i(ii) Where the merger or takeover could, through the
abuse of market power, result in undue restriction
of competition or have an adverse effect on trade
or the economy.
In making a judgement, the Commission follows steps
in evaluating a merger or a takeover. A comprehensive assessment is undertaken which carefully examines among
other factors the following:ii(i) Defining the market;
i(ii) Market shares and concentration;
(iii) The extent of import competition;
(iv) Barriers to entry; etc
i(v) Countervailing power, etc.
One can distinguish between three fundamental types
of mergers, namely: horizontal, vertical and conglomerate
mergers. This will be covered by the other speakers.
However, certain specific remedies are employed by
the Commission for the effective enforcement of the
merger control law. The law on mergers requires advance
notification to the Zambia Competition Commission. The
purpose of such a requirement is to permit the Commission to prevent consummation of an anti-competitive
merger before it occurs, because it is extremely difficult
to break apart a merger that has been consummated.
In addition to having the ability to issue an order prohibiting consummation of an anticompetitive merger, the
Commission has power to permit the merger, subject to
certain requirements, including observing a remedial order or divesting some, but not all, of the assets of either of
the merging enterprises.
+RUL]RQWDOUHVWUDLQWV
The Act prohibits all forms of horizontal arrangements
which have the effect of restricting competition. These arrangements generally refer to agreements between firms
competing with identical or similar products in the same
market. These arrangements are outright prohibited under
the Act, they cannot be authorised by the Competition
Authority. The Act specifically prohibits the following
trade agreements:
—Price fixing
—Collusive tendering
—Market or customer allocation
—Sales/production
—Refusal to supply
—Collective denials of access to an arrangement
9HUWLFDOUHVWUDLQWV
The Act further goes to identify a number of specific
practices, more especially vertical agreements between
competing firms with identical or similar products in the
same market, which are outlawed to the extent that they
limit access or unduly restrain competition through an
abuse of market power. The Act makes express reference
to the following practices:
—Predatory behaviour
—Discriminatory pricing
—Exclusive dealing
—Bundling and tying arrangements
—Resale price maintenance
Some of the practices mentioned and related to vertical
arrangements are widely used commercial practices.
They may often be legal, provided that their use is not intended to restrict competition and does not represent an
abuse of market power. The Commission can authorise
the use of such commercial practices, following an application by the parties concerned, if it considers that this
would be consistent with the objectives of the Act.
$EXVHRIGRPLQDQWSRVLWLRQ
The abuse of dominant position is one of the key elements of the Act. For the provision to apply, one or more
persons must substantially control a class of business
throughout Zambia or substantial part of it, and have engaged in or currently be engaging in a practice of anticompetitive acts that have the effect of preventing or lessening competition substantially.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
The law, requires dominant firms not to be permitted to
use their advantage to block challenges from existing or
potential competitors. The abuse of dominant provision is
particularly important in the context of a deregulated and
privatised business environment and can be instrumental
in assisting the transition from regulation to deregulation.
Moreover, it helps to ensure that dominant firms do not
preclude the competition discipline promised by the removal of trade barriers and increased foreign competition.
It is important to note that the emphasis of the law is
upon the activity of an enterprise rather than its status.
Consequently, the holding of a dominant position is not
prohibited, but the abuse of the dominant position.
&RPSHWLWLRQSROLF\DQGFRQVXPHUZHOIDUH
Unlike other Competition Authorities, in Zambia, the
Zambia Competition Commission (ZCC) has also the legal mandate to deal with matters pertaining to consumer
affairs. Firstly, you will observe that there is a large
number of consumer organisations, both governmental
and non-governmental, business interests, enforcement
bodies and other interested parties, which are active in the
field of Consumer Affairs. On the Board of the ZCC,
there are two representatives from the national non-governmental consumer associations.
The ZCC has identified what work on consumer affairs
it should engage in, and how it should allocate resources
between different types of activities. It has also developed
a strategy aimed at providing the various bodies with
guidance on how they might be affected by the work
undertaken by the ZCC.
The ZCC’s strategy has taken into account the need to
work effectively with those other bodies. This strategy by
the Commission aims to help maximise consumer welfare
in the longer term, subject to protecting the interests of
vulnerable consumers, by:
—Empowering consumers through information and
redress;
—Protecting them by preventing abuse; and
—Promoting competitive and responsible supply.
The Commission recognises the fact that, in general,
consumers are the best judges of their own interests: consequently, it is for them to make choices for themselves,
based on those interests and accordingly to their own
values.
While direct intervention by the ZCC may be necessary when things go wrong, the main thrust should be directed at empowering consumers to look after themselves.
The main tool needed to enable them to do this is information. Consequently, the essential part of the Commission's
work is to promote the availability of information, either
by encouraging others to provide it, or by doing do itself.
It is always evident that where there is effective competition and sufficient information for consumers, dishonest traders cannot thrive. It is in this regard that because of
imperfect markets, that regulation sometimes is necessary
to ensure that consumers are adequately protected. The
Commission also in a way provides an effective and
accessible redress mechanism which forms an essential
element of good consumer protection.
$XWKRUL]DWLRQRIDOORZDEOHDFWV
$XWKRUL]DWLRQDQG1RWLILFDWLRQ
Part III of the Competition and Fair Trading Act is
based on the fundamental principle that any conduct
which has the purpose of substantially lessening competition in the market should be prohibited, while recognising
that, in certain circumstances full competition may not
deliver the most desirable outcome.
The Act, however, recognises that some objectives of
our society may not always be met by the operation of the
competitive markets. To secure such objectives, exemptions from the application of the Act are available. The adjudication (Authorisation and Notification) procedures
under the Act provide the exemptions. It is important to
note that the adjudication procedures apply only to specific parts of the Competition and Fair Trading Act. For example, do not apply to any of the consumer protection
provisions of the Act.
To spare people the process of undergoing an investigation by the Commission or risking an action being
brought on by a third party, the act provides a mechanism
for authorisation by which the Commission may grant immunity from legal proceedings for certain arrangements
or conduct that may otherwise contravene the Act. The
outcome provides a greater degree of business certainty,
important when a major investigation decision or other
market initiatives are proposed.
Authorization of some types of anti-competitive behaviour is possible if the public benefit exceeds the detriment to the competition.
The Commission may grant immunity on the public
benefit grounds from legal proceedings for some arrangements or conduct that might otherwise breach the restrictive trade practices provisions of the Act.
Authorization is a process whereby the Commission,
in response to an application has the power to grant immunity from court action for arrangements or conduct
which might otherwise be in breach of the Competition
and Fair Trading Act. To grant authorisation the Commission must be satisfied that the public benefit stemming
from the arrangements contact outweigh any anti-competitive effect. To assist the Commission in its consideration of the application it would be helpful to have as wide
a range of views as possible concerning the public benefits and anti-competitive effects of the arrangement or
conduct.
Certain types of conduct referred to under Section 9(3)
of the Act are inherently anti-competitive. The Commission is unlikely to grant immunity from prosecution in respect of such conduct. They types of restrictive business
practices mentioned in Section 7(2) of the Act may not be
anti-competitive depending on the precise circumstance
of each case, and negative clearance for such conduct
under Section 13 is possible.
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
A person or enterprise may seek immunity from the
possible prosecution under this section by notifying the
Commission that it is undertaking or is proposing to
undertake such conduct or acts which, it is inclined, will
not have an adverse eff ect on competition or trade or the
economy in general.
sion of the Act or any regulations made thereunder, or any
person who omits or refuses to furnish any information or
to produce any document required by the Commission. It
is also an offence to knowingly furnish any false information to the Commission. Those found guilty are liable to a
fine or imprisonment or to both.
In the light of the information provided by the applicant or others, the Commission may decide to take no action to stop the notified conduct thus providing the immunity sought (negative clearance). Alternatively, the
Commission may determine that the conduct has or will
have an adverse effect on competition or the economy and
issue a notice requiring the person or enterprise to cease
the conduct or practice within a specified period from the
date of the issue of notice.
7KHZD\IRUZDUG
3RZHUVRIHQIRUFHPHQW
Mr. Chairman, let me now look at the power of enforcement available to the Commission. You will agree
with me that the effectiveness of the competition law in
addressing anti-competitive practices, depends on the actual degree of enforcement action by the Competition
Authority and role of the courts or the judiciary in the
enforcement of the competition law.
Vigorous, well targeted law enforcement goes hand in
hand with advocacy. Competition law enforcement prevents economic agents in the market from distorting the
competitive process either through agreements with other
companies or through unilateral actions designed to
exclude actual or potential competitors.
To help the Commission in its functions of exercising
strict control over all forms of anti-competitive practices,
the Act gives the Executive Director and other officers of
the Commission, the rights to apply to Court for a warrant
granting them authority to enter any premises and seize
records or other documents relating to the trade or business of any person, they feel are necessary to prove to the
Commission of an offence under the Act.
Under the Zambian law, the Commission may opt to
apply to the Director of Public Prosecution to allow them
to have their own prosecutors to prosecute offenders
under the Act.
The law further stipulates offences and penalties for
persons who contravene or fail to comply with any provi-
Finally, I may ask, what is the way forward for the
Zambia Competition Law and Policy? Zambia like other
countries in the region still is facing teething problems in
the administration, enforcement and implementation of
competition law and policy. The same problems are applicable in different degrees to all the countries in the region.
Although the enactment of the competition law was designed to remove the impediments in the market and create a level playing field for big, medium and small-scale
business organisations, the effectiveness of the law is
however reduced by several factors:
—Weak capacity to review and decide on complaints concerning anti-competitive behaviour;
—Weak capacity to investigate predatory mergers
and acquisitions;
—Weak capacity to co-ordinate with regulatory
bodies to enhance “competition for the market” in
the provision of infrastructure services;
—Weak institutional capacity to develop procedures for alternative methods as well as use of
courts for solving conflicts arising from anticompetitive behaviour;
—Low level understanding and awareness about
competition law, procedures and remedies by
consumers, business community and parastatals.
The eliminating of these impediments is essential for
meaningful development of a competitive market system.
The Zambia Competition Commission is determined to
remove these impediments by designing a strategic action
plan for identifying and developing options to remedy legal and institutional constraints, capacity building and developing an operations manual. Above all, there is need to
establish a working relationship with enterprises, business people and trade associations. Thank you very much
for your time.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
7UHDWPHQW RI PHUJHUV DQG WDNHRYHUV LQFOXGLQJ
UHJLRQDO DQG LQWHUQDWLRQDO PHDVXUHV
%\-DPHV0DWKLV
Trade Law Program Coordinator
Department of International Law, University of Amsterdam
,QWURGXFWLRQZK\PHUJHUFRQWURO"
formation is so closely associated with the process of privatisation, the business of selling state monopoly assets
raises the prospect that assets once privatised are likely to
be dominant.
One may ask why developing or transition economies
should have any business discussing the adoption of
merger control (MC) in either national system or regional
groupings. Any reference to historical pattern would
simply indicate the developed countries, at least some of
them, use merger control and that the consideration of
adopting MC has appeared to come late in the competition
policy scheme of evolution. The EC itself is a good example. Articles 85 and 86 were provided in the original
Rome Treaty (1957) and given effect by Regulation 17 of
1962. The regulation for control of concentrations in the
EC did not arrive until 1989.
It is at this step that a case for MC can be made. Since
the state will no longer “regulate” as owner, and is intent
on reducing its role as regulator of new private enterprise,
it would seem reasonable to suggest that any analysis of
the market structure of prospective concentrations, and
the manner in which they may likely behave on the market, should be considered as an aspect of the decision to
divest. Thus, MC aspects could play a helpful role
throughout the process: to first determine the competitive
components of a larger asset to be divested prior to tendering; to obtain valuable market information from prospective buyers, which in many cases will serve as the
only available data base for the sector; to assist in framing
negotiation goals so that related supply and distribution
aspects of the sale may be rendered more competitive for
local firms; and finally, to provide a point of reference for
later investigations of traditional competition policy aspects if the new concentration is later abusive or engaged
in cartel activity.
One may also note the some common advice given by
developed country experts on this subject. That is, small
and/or developing countries are not large enough economic players to give meaningful effect to merger control
on their territories. Their resources are limited and larger
actors are not likely to be responsive to notification requirements, let alone investigative procedures. If the little
territory attempts to assert MC in regard to a change in
concentration on the local market, what is more likely to
occur is that the larger actors will simply bypass investment upon that territory altogether, and thus deny that
market whatever pro-competitive aspects the change in
control might have been able to deliver to those consumers.
For these items, it is not so clear that a local MC
authority need necessarily have the final power to block
investment decisions, or even where such power was provided, that authorities would then seek to block
international mergers which have greater effects upon
other markets. It is not even so sure that a system of vetting privatisations between investment/competition agencies actually requires a separate notification provision to
be made by undertakings. Rather, what is suggested for
consideration is that any policy of promoting transformation by privatisation should be acknowledged at the responsible level to have a competition policy facet with
implications for the quality of the resulting market. Since
the purpose of the process is ostensibly to create “market
economy”, then the characteristics of this resulting market should be of concern for the parties undertaking the
sale of assets. From this it follows that the relationship between agencies which sell assets and those which enforce
competition policy should be structured in a manner so
that the role of each may reinforce the role of the other.
What is not so clear in this advice is whether it is intended to be applicable to all small countries, or just the
poorer of them. Holland has adopted merger control notification in the recent past. It is however only a market of
about 15 million people, notwithstanding that its economy is in the largest group of ten. Likewise, some developing/transition economies are enormous in regard to the
size of the consumer base which may potentially be
affected by new concentrations.
More important, certain practical differences relating
to the particular problems of transformation economies
appear to raise the issue of merger control. This also appears to occur an earlier stage of developments than has
been observed for developed countries with longer
records of private enterprise culture and lower historical
levels of state intervention in the markets. For the new
market economies, state ownership of primary economic
sectors has been the rule rather than the exception. For the
smaller of them, markets are said to be too thin to support
a multitude of players. Since the process of market trans-
,
:KDWLVPHUJHUFRQWURO"
Although the point of this essay is not to provide any
detailed descriptions, several definitional points are
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
raised which illuminate the points made above. First, the
descriptive “merger” control is a misnomer. More accurately, the control of “concentrations” is the matter to be
considered, as this term contemplates any type of operation or operations which bring about a lasting change in
the structure of the undertakings concerned. In this respect, the concept of “control” is essential to understanding the role of MC, as it is a change in the control of an
undertaking(s) which is sought to be captured by a concentration control procedure. This definitional point allows us to delineate merger control from other enforcement procedures directed to pre-existing dominant
positions or to abuses of such positions in the market.
What is sought to be addressed by MC is the possibility or
likelihood that a change in control of the undertakings
concerned may act to effectively impede the quality of
competition on the territory market. Thus, MC may be defined as a system or procedure for vetting or reviewing
proposed concentrations which may result in the impeding of effective competition on the market.
Given this definition, other types of operations also fall
within a merger control system. Besides mergers between
independent undertakings, acquisitions of one undertaking by another also qualify. Likewise, certain joint ventures are subject to the review. Under EC law for example, full-function Joint ventures, which are autonomous
and do not operate to coordinate the partner undertakings,
are treated as concentrations for the purpose of MC
Regulation. Also addressed in the EC regulation are such
changes control that are not effected by a change in the legal personality of the resulting undertaking, but rather result from agreements between owners to vote stock in a
certain manner or to exchange stock in order to change the
control of a single undertaking.
,,
(OHPHQWVRIPHUJHUFRQWUROV\VWHPV
Several institutional characteristics of MC are identified. First is the concept of MXULVGLFWLRQ which includes a
definition of a territory, the geographical area over which
a national (or regional) authority exercises its legal power.
This may appear obvious for countries, but is not obvious
for regional merger control systems, a matter taken up below. Also within the concept of jurisdiction is a reference
to size or “dimension” which specifies that changes in
control of undertakings below a certain size are not legally subject to the power of the MC authority. While the EC
regional system applies a complex combination of factors
including size (turnover) of firms on the world, the Community and member state markets, more simple national
systems are also evident which only specify a resulting
territory market share as a basis for activating the MC
system.
A second element is that of QRWLILFDWLRQ, the legal burden placed upon undertakings to declare the impending
changes of control contemplated. The materials included
in the notification disclosure provides the information
necessary for the authority to initiate an assessment of the
resulting concentration. Common disclosures include the
undertaking’s description of the products and /or services
concerned, the relevant product and geographic markets,
the nature of the legal transaction which is occurring, and
the resulting market shares of the concentration on the
market.
This process of disclosure informs the third element,
that of LQYHVWLJDWLRQDQGDVVHVVPHQW. Since most changes
in control are pro-competitive, the distinction is drawn
here between MC systems and traditional competition
policy procedures. The authority must have the dedicated
resources to determine with dispatch that pro-competitive
concentrations are not likely to impede competition on the
market. Otherwise, economic restructuring that would
otherwise be beneficial is simply frustrated. This consideration has led a number of territories to forego MC on the
basis that if they cannot apply sufficient resources to do it
well, that it is better not to do it at all.
Finally, an element of HQIRUFHPHQW is evident where
the authority has power to address the undertakings for
additional disclosure, to recommend or require modifications in the structure of the resulting concentration, or to
finally direct that the concentration shall not be permitted
to be effected on the market. A system may provide for
fines and penalties for failing to notify or for providing
false or misleading information. Fines and penalties, including seizure of local assets, is provided in a number of
systems for the enacting of a concentration that has been
ordered to be blocked or modified by the authority. It is
the case that these remedies are rarely applied. MC review
by nature tends to be negotiative with modifications
occurring by agreement early in the process.
,,,
1DWLRQDOFRQVLGHUDWLRQV
The elements described for MC can be incorporated as
an aspect of the process of investment review. For notification, competition policy information can be incorporated into the process of disclosure which would accompany
the tendering process for assets. The notice aspect in some
cases may even be established as an internal element
whereby the investment authority reviews thresholds and
informs the competition authority. Where jurisdiction is
apparent, perhaps a second level of disclosure by undertakings is attempted, either independently by the MC
authority, or by the investment authority acting in this regard as an agent. Investigative inquiries and initial findings can also operate internally between competition and
investment authorities which have a basis for continuing
contact with the undertakings concerned, and also have a
basis to conduct negotiations which may affect the resulting structure or its practices in the market. At the lowest
level of interference, even where the MC authority is not
given power to intervene to either modify or block divestment, even the right to obtain quality product and market
information and/or the right to review and report could be
valuable later in establishing abuse of dominance if practices on the market warrant a later investigation.
For the difficult cases mandated by economic or budgetary reality where the purchaser is being promised continued dominance by either suspension of national competition policy or application of trade measures, there may
yet be room to manoeuvre if the MC authority is not
locked-out of the process. Even while horizontal protection is visibly accorded, a competition authority is in the
best position to fight the case for eliminating vertical re-
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
straints which may be so necessary for the participation of
local firms and future entrepreneurs. Likewise, if dominance is only promised for a period of time, the ability to
monitor from an original baseline understanding of the
market may assist in closing out measures which are no
longer required by the agreement of sale.
,9
5HJLRQDOFRQVLGHUDWLRQV
It has been argued that the necessity of MC within a regional formation flows directly from the level of integration actually being achieved on the region. At the point
where regional members contemplate a larger market
within which business will understand that it is doing
business across the overall market, or some significant
part of it, then a regional dimension can be said to have
emerged which justifies regional merger control. “Doing
business” should also be understood to relate to provision
of services across borders, as investment is so closely related to delivering services. It follows that the regional
market exhibit free factor movements for capital and also
probably for labour. As in the EC example, the merger
control regulation of 4064/89 provides by its preamble
that the completion of the internal market program provides a justification for a regional jurisdiction where economic actors make investment decisions which affect the
overall market.
There can be a case made for developing country formations to consider regional merger control prior to the
level of integration outlined above. Besides the point of
expediency for business whereby firms can make a single
regional filing and thereby avoid a number of smaller MC
authority procedures, there is also the situation where a
number of national authorities operate without MC at all.
If there is a reason to believe that the individual membercountry markets are likely to be subject to the same
sources of inward bound acquisitions/investments which
will have similar effects on these markets, then the prospects of pooling resources to form a single operational entity may appear attractive.
ered for its advantages. However, the resources provided
to assess regional notifications may not be sufficient for a
number of reasons. What may be suggested is that while
a regional definition of territory and notification is provided, that initial assessment is made at the regional level
by representatives of member national authorities composed for this purpose. Where additional investigation is
determined to be required, then a number of possibilities
present themselves by the use of referral to a competent
national authority and perhaps by the application of positive comity for authorities with superior investigative access to examine the merger on behalf of the region. The
regional authority may retain the power to make a final
decision, or as above, representatives of national authorities acting together may hold this power. Thus, although
the establishment of a regional system suggests centralisation, after the elements of jurisdiction and notification
are met, number of decentralising possibilities can be considered.
&RQFOXVLRQ
Although MC appears to occur somewhat later in the
integration process among countries in regional groupings, for individual countries engaged in significant economic transformations, it is suggested here that MC
should be considered at an earlier juncture. Where a privatisation effort is being undertaken, the opportunity to
affect the quality of the resulting market is offered only
once, as an asset is divested only once. While any competition authority consumes scarce resources, some of the
benefits of merger control may be realised by utilising
less than formalised procedures between agencies responsible for investment and for competition policy. Regional
considerations are more complex in the manner in which
the elements of MC are applied, both as to the legal form
of the subject grouping and in the degree that centralised
systems are contemplated as necessary to provide for a
credible regional response.
5HVRXUFHV:
The element of jurisdiction is less obvious in regional
systems as compared to nations. The legal form chosen
for the grouping may also have a bearing on the geographical territory element A customs union creates a customs territory which readily serves as a geographical expression of jurisdiction. Although a free-trade area does
not create a separate customs territory, where a free-trade
area does provide for a basis for regional (cumulative)
mixing of inputs or processes, then investment decisions
may also follow to take the overall market into consideration. Thus, regional MC should not be disregarded in
free-trade area formulations solely because a customs territory is not created.
Ehlermann, Claus-Dieter, (1994), 7KH ,QWHUQDWLRQDO
'LPHQVLRQRI&RPSHWLWLRQ3ROLF\, Fordham International
Law Journal, V.17, N.4, pp.833-845.
An advanced question is whether a centralised system
is required in order to effect a functional MC system, or
whether co-operation between national authorities can be
made sufficient. For firms, the substitution of a single notification at the regional level in place of separate national
filings is seen as a significant benefit, at least as a lesser
of two evils. Where a territory dimension for concentrations has been defined on a regional level, a single notification for concentrations on this territory must be consid-
Starek III, Roscoe B., (1996), ,QWHUQDWLRQDO$VSHFWVRI
$QWLWUXVW(QIRUFHPHQW, World Competition, V.19, No. 3,
p. 29-53.
Kines, Stephen, &RQILGHQWLDOLW\&RQIOLFWVDQG&RPLW\,
Netherlands International Law Review, V.43, No.1,
pp.19-32.
Mathis, James, (1998) ,QVWLWXWLRQDO $VSHFWV RI
5HJLRQDO0HUJHU&RQWURO, World Competition, V. 21:3,
pp. 29-43.
Scherer, Frederic M. (1994), &RPSHWLWLRQ3ROLFLHVIRU
DQ ,QWHJUDWHG :RUOG (FRQRP\, Brookings, Washington
D.C.
Török, Adam, (1997), Competition Policy and Market
Restructuring in the Hungarian Transition, in Rules of
Competition and East-West Integration, Fritsch M., and
Hansen H., (eds.) Kluwer Academic Publishers,
Dordrecht.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
7RZDUGV D SRVLWLYH DJHQGD IRU PXOWLODWHUDO QHJRWLDWLRQV RQ
FRPSHWLWLRQ SROLF\ LQWHUHVWV RI GHYHORSLQJ FRXQWULHV
%\-DPHV0DWKLV
Trade Law Program Coordinator
Department of International Law, University of Amsterdam
,
,QWURGXFWLRQ:
,,
Many developing countries do not yet have competition laws and many claim little or no interest in adopting
them. It would seem to follow that they should likewise be
indifferent to the issues regarding international/multilateral rules for anti-competitive (restrictive) business practices. However, the interests of lesser-developed countries in multilateral competition rules may be accented
because of their relatively weaker position in the global
economy and its trading system. This point follows if one
applies a traditionally expressed goal for competition
rules, which is to provide assurance that the “game” of
contesting markets by private actors shall be enforced to
insure its continuation. This suggests that small as well as
large must retain some potential for having access to the
field of play in order to compete.
7KHFDVHIRULQWHUQDWLRQDOFRPSHWLWLRQUXOHV
We start from the position that any set of rules which
act to restrain unilateral behaviour by territories will tend
to benefit the smaller parties. The capacity to exercise
unilateral behaviour in international trade is related to the
ability to discriminate between trading partners. The primary instrument, though not the only one, to effect unilateral and non-compensated discrimination is antidumping.
While many smaller and developing countries have
passed antidumping laws in recent years, the potential use
of these instruments as retaliatory is limited, as the a
threat of foreclosure from a larger market will carry the
greater weight in any exchange between large and small.
The ability to use trade threats depends upon which party
will be greater damaged by the cessation of trade.
Thus, to the extent that any formulation of international rules regarding anti-competitive business practices may
act by law or by practice to reduce the incidence of dumping and/or antidumping in international trade, this development would benefit those territories which are less
capable of imposing trade threats in the first place.
This view of competition policy conflicts with the narrower perception that national competition policies are
anti-competitive in effect where they only serve to promote the market-access opportunities of the larger global
enterprises. This perspective ignores the potential that
international rules, and perhaps regional rules, may offer
to developing countries. Embedding the traditional competition policy principles into an international framework
would serve to extend the reach of local authorities. This
would assist them in insuring that newly-opened markets
remain actually contestable, first to insure that international players are in competition on the local market, and
second, to provide new tools to insure that there is space
remaining on the local field of play for local enterprise to
also compete.
A second aspect which relates to size and development
level refers to the home jurisdictions of international
firms. As they operate across a large number of territories,
any restrictive agreements or practices undertaken by
them will have their intended effects on third territories
even while the evidence of agreements and decisions
made will not be will not located in these territories. Although any national competition law may provide for outof-territory jurisdiction to investigate practices, the authority in the superior position to actually engage investigations and to compel meaningful disclosures is that
authority located in the jurisdiction where agreements are
made. Therefore, any set of rules that can act to extend the
reach of local investigation powers by co-operation or
otherwise should be viewed as a favourable development
by smaller or developing country authorities.
This essay will first elaborate on the position of developing countries in international competition rules and
contrast this view with that attributed to developed countries. Then, the original International Trade Organisation
(ITO, Havana Charter, 1947) provisions will be noted to
demonstrate how a complaint and reporting system was
contemplated for restrictive business practices which affected international trade. Finally some suggestions for
developing-country positions on question of international
rules are made, including the consideration of a non-WTO
approach which would imitate the ITO features in an open
and informal network between national authorities
,,,
5HFHQWHYROXWLRQRIWKHPXOWLODWHUDOFRPSHWLWLRQ
SROLF\LVVXH
Although developing countries have long advocated
international competition rules (UNCTAD, ‘The Set …’
1981) the re-emergence of this topic in the mid 1980s was
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
led primarily by the interaction of developed countries,
notably the United States in its ongoing trade issues with
Japan. As Japan was bound at lower tariff levels after the
Tokyo Round (1979), US policy increasingly identified
non-tariff barriers as an explanation for market-access
problems. Through programs such as the strategic impediments initiative (SII), technical barriers were raised, as
well as a number of problems that could be loosely collected together as competition policy issues. Even recently this market-access orientation has been analysed in a
WTO trade dispute (Japan—photographic film, 1997).
Here, the US alleged a failure of Japan to enforce its domestic anti-trust laws with the effect that reasonable expectations of market access relating to tariff-bound
products was not being realised. This market-access
orientation for the use of national competition rules can
also be found as providing a cause of action in various US
legislation addressing of unfair trading practices of other
countries, as well as in the EC unfair trade practices regulation.
The EC has taken something of a lead in setting forth
proposals for an international framework for competition
policy. Following the Uruguay Round (1994), the European Commission requested a group of experts to provide
reports on the question of international rules. What
emerged was a proposal for a plurilateral code for competition rules to function within the multilateral trading system. The EC experts also demonstrated some sense of balance in basing their recommendations not only upon the
EC’s problems of market access to other territories, but
also by forwarding proposals which were responsive to
the interests of developing countries in the formulation of
international rules. Thus, while the report documented
that “outward bound” anti-competitive directed from the
EC market were not prohibited, that the concept of international anti-trust should accommodate a prohibition,
agreed upon by all parties, against certain “hard core”
practices, including export cartels and assumedly, certain
international cartel activities.
,9
7KH,72LGHD
The 1948 Havana Charter for the ITO, which did not
go into legal effect, contained a chapter dealing with restrictive business practices which affect international
trade. These provisions also appear to recognise the interests which would naturally be accorded to developed as
well as developing territories. Thus, the new ITO members would have been obliged to prevent,
“on the part of private or public commercial enterprises, business practices affecting international trade
which restrain competition, omit access to markets,
or foster monopolistic control.” (Havana Charter
chapter V, Art. 46:1)
This chapter did not seek to create an international police force for competition problems in international trade.
Rather, like the early dispute settlement provisions generally, it provided that a member, on behalf of its national
firms, would have a right to make a complaint to the ITO
and then receive an independent report. This report would
make a finding as to whether or not the practice alleged
fell within a listed set of prohibitions (see addendum
attached) that were stated in the chapter. If so, the respondent territory member was requested to take remedial
measures in regard to firms located within its territory.
This member could also be asked to re-appear before the
ITO and indicate what remedial measures had actually
been taken.
Although these provisions seem minimal compared to
ambitious proposals for international enforcement agencies, in point the complaint/reporting idea is an advanced
concept with implications for trade relations between developed and developing countries. Retrospectively, this
reporting function might have documented the existence
of trade restrictive aspects of restrictive business practices
even if respondent territories chose to not take remedial
measures. Reports might have cumulatively generated a
body of legal interpretations as to how particular practices
relate to the ITO list of prohibitions. Over time, one can
also contemplate that a complaint and reporting feature
might have evolved to be eventually assimilated into the
formalised dispute settlement provisions, as now contained in the WTO-DSU.
The reason for looking back on the ITO complaint/reporting procedure is to reflect upon what value such a procedure would hold for today’s situation and to frame a
suggested direction which would respect the interests of
developing countries in international rules for anti-competitive practices. The suggestion is made here that a reporting system, like that described in the ITO procedures,
could be accommodated in the WTO, with a similar list
included of prohibited practices which would form the basis for making legal conclusions as based upon the factual
findings of independent reports.
9
7RZDUGVDSRVLWLYHDJHQGD
Since all WTO members could have occasion to use
such a system, it is difficult at the outset to discern why
any member would object to such a development. However, country differences may also play a role here. Since
the largest international firms are based in just a few territories, it is said that the largest number of complaints
would be directed to the national authorities of those territories. Thus, the mere provision of a reporting procedure
would tax even those large national authorities who also
do not have the resources to respond to all of the internal
anti-competitive practices in their markets, let alone those
practices engaged by local firms operating externally.
Three points are made in response. First, the ITO reporting procedure does not necessarily compel a domestic
national authority response nor does it imply that a national competition authority is necessarily the appropriate
party to make a response. While effectiveness of investigation is diminished without the respondent’s participation, a reporting agency can collect information from other territories that are also claimed to be effected. While
this may not generate a complete report, the result may be
better than no report. Related, a national authority has jurisdiction over the quality of competition on its national
market. It may be that external relations authorities derive
a better domestic legal basis to act as the respondent party.
Second, whatever the appropriate agency to make response, developed authorities are already implementing
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
bilateral positive comity procedures which assume responsibility to investigate outward-bound practices.
Thus, resources are being committed in this manner
gradually, but only between particular authorities and
their respective territories. It may be more work to contemplate whether a particular cartel allegation affects
more than one other territory, but as long as resources
have been committed to investigate the activities anyway,
then why not consider the broader territorial implications.
Finally, as in the EC proposal, there is always the preemptive alternative to prohibit the same set of outwardbound activities that are already prohibited domestically.
This option has the potential to relieve authorities of the
burden where national courts can be engaged to handle
foreign claims.
There is also an alternative for countries to obtain the
benefits of a complaint and reporting system for international anti-competitive practices affecting trade. Just as
existing bilateral co-operation agreements are outside the
WTO framework and therefore are not required to extend
their benefits by MFN to other authorities, any set of territories can establish communication and co-operation between their existing competition authorities and on their
own initiative. Such a network need not be exclusive, but
rather could be open to any territory. By utilising modern
information networks, the sharing of complaints and the
passing of non confidential information that is wholly in
the public domain, like prices and disclosed market
shares, could also form the basis for initial report information. Perhaps such a network could be open for any national authority willing to dedicate a representative to facilitate its participation in the process of investigation and
reporting and, while acting with others, the preparing and
approving of reports.
therefore view competition rules generally as an undesirable market-opening mechanism. In contrast, there are
others that have taken significant market opening measures and see a need for competition rules as a marketenforcing policy which responds to inward investment in
respect to the formation of new dominant positions.
That there is no common position at this time should be
viewed in context. Multilateral rules were offered by
some developing countries at the outset of the Uruguay
Round in 1986 without accommodation. Since then, the
position of developing countries in the trading system has
dramatically changed. Then, a great number of the lesser
developed were functioning as non-market economies
with high levels of state ownership. Few had national
competition rules. In years since, all acknowledge that the
degree of transformation to market-based economies with
primary reliance upon private actors is an astounding
occurrence.
&RQFOXVLRQ
Consideration of the territories engaging these transformations should cause a revaluation of the international
competition policy issue, particularly as the requests by
transforming territories for international rules is so directly related to the resulting quality of the competitive markets commencing to take root upon their territories. Market competition is, after all, the point of the exercise
known as market transformation. While the consideration
of a complaint/ reporting requirement is not really so invasive to the interests of developed parties, it does offer a
bridge for the developing countries to answer the oftenheard claim that “openness” means “dominance”. From
this view, it may appear in the last analysis to be somewhat disingenuous on the part of the most developed to
refuse developments which are consistent with a rulesbased international trading system, eliminate recognised
distortions to trade, and which promote the progress many
have made to foster the culture of competition in their territories.
The possibilities for engaging the competition policy
issue in the WTO does not look particularly promising at
this juncture. Although a number of developing countries
are in favour of raising the item, this is also not a common
position among the large and varied group of territories in
the WTO, developing or otherwise. One of the dividing
lines that may be evident falls lies between developing
countries that remain relatively closed to imports and
For them, the multilateral option of securing a complaint and report procedure should continue to be pressed.
At the same time, independent co-operative arrangements
which commence the exercise between authorities outside
the WTO framework should also be explored with the
goal of evolving a process of documentation regarding the
suspected practices in a procedure dedicated to credible
and balanced reporting.
$''(1'80
,72+DYDQD&KDUWHU5HVWULFWLYH%XVLQHVV3UDFWLFHV
+DYDQD&KDUWHUFKDSWHU9DUWLFOHSDUDJUDSK
“The practices referred to … are the following:
a.
fixing prices, terms or conditions to be observed in dealing with others in the purchase, sale or lease of any product;
b.
excluding enterprises from, or allocating or dividing, any territorial market or field
of business activity, or allocating customers, or fixing sales quotas or purchase quotas;
c.
discriminating against particular enterprises;
d.
limiting production or fixing productions quotas;
e.
preventing by agreement the development or application of technology or invention
whether patented or unpatented;
f. extending the use of rights under patents, trade marks or copyrights granted by any
Member to matter which, according to its laws and regulations, are not wihtin the
scope of such grants, or to products or conditions of production, use of sale which are
likewise not the subjects of such grants;
g.
any similar practices which the Organization may declare, by a majority of two-thirds
of the Members present and voting, to be restrictive business practices.”
5HJLRQDO FRPSHWLWLRQ SROLF\ IRU &20(6$ FRXQWULHV
DQG LPSOLFDWLRQV RI DQ )7$ LQ %\-0XVRQGD
Trade Advisor
COMESA Secretariat
%DFNJURXQG
An Interim Council of Ministers, assisted by an Interim
Economic Committee of officials, was subsequently set
up to negotiate the treaty and initiate programmes on economic co-operation, pending the completion of negotiations on the treaty.
The Common Market for Eastern and Southern Africa
(COMESA) is a regional integration grouping of 21 African sovereign states (Angola, Burundi, Comoros, Democratic Republic of Congo, Djibouti, Egypt, Eritrea, Ethiopia, Kenya, Madagascar, Malawi, Mauritius, Namibia,
Rwanda, Seychelles, Sudan, Swaziland, Tanzania, Uganda, Zambia and Zimbabwe) which have agreed to promote regional integration through trade development and
to develop their natural and human resources for the
mutual benefit of all their peoples.
In 1978, at a meeting of Ministers of Trade, Finance
and Planning in Lusaka, the creation of a sub-regional
economic community was recommended, beginning with
a sub-regional trade area which would be gradually upgraded over a ten-year period to a common market until
the community had been established. To this end, the
meeting adopted the “Lusaka Declaration of Intent and
Commitment to the Establishment of a Preferential Trade
Area for Eastern and Southern Africa” and created an
Inter-governmental Negotiating Team on the Treaty for
the establishment of the PTA. The meeting also agreed on
an indicative time-table for the work of the Intergovernmental Negotiating Team.
COMESA was established in 1994 to replace the Preferential Trade Area for Eastern and Southern Africa
(PTA), which had been in existence since 1981 within the
framework of the OAU’s Lagos Plan of Action and the Final Act of Lagos. The PTA was established to take advantage of a larger market size, to share the region’s common
heritage and destiny and to allow greater social and economic co-operation, with the ultimate objective being to
create an economic community.
After the preparatory work had been completed a meeting of Heads of State and Government was convened in
Lusaka on 21st December 1981 at which the Treaty establishing the PTA was signed. The Treaty came into force
on 30th September 1982 after it had been ratified by more
than seven signatory states as provided for in Article 50 of
the Treaty.
COMESA is one of the more successful regional economic co-operation and integration groups in Africa. Supported by its financial specialised institutions, namely the
Trade and Development Bank For Eastern and Southern
Africa, (PTA Bank) the Clearing House and the Re-insurance Company, COMESA, and before it, PTA, has a
proven track record of achievements. Over the past fourteen years, it has developed a large number of regional
programmes which are assisting member States, in a
positive way, to attain economic recovery and sustainable
economic growth.
The PTA Treaty envisaged its transformation into a
Common Market and, in conformity with this, the Treaty
establishing COMESA was signed on 5 November 1993
in Kampala, Uganda and was ratified a year later in
Lilongwe, Malawi on 8 December 1994.
0DLQ2EMHFWLYHVRI&20(6$
The COMESA Treaty, which sets the agenda for
COMESA, covers a large number of sectors and activities. However, the fulfilment of the complete COMESA
mandate is regarded as a long-term objective and, for
COMESA to become more effective as an institution, it
has defined its priorities within its mandate, over the next
3 to 5 years, as being 3URPRWLRQRI5HJLRQDO,QWHJUDWLRQ
WKURXJK7UDGHDQG,QYHVWPHQW. The role of the COMESA
Secretariat is to take the lead in assisting its member
States to make the adjustments necessary for them to become part of the global economy within the framework of
WTO regulations and other international agreements.
)RUPDWLRQRI&20(6$
In 1965, the United Nations Economic Commission
for Africa (ECA) convened a ministerial meeting of the
then politically independent states of Eastern and Southern Africa to consider proposals for the establishment of
a mechanism for the promotion of sub-regional economic
integration. The meeting, which was held in Lusaka,
Zambia, recommended the creation of an Economic Community of Eastern and Southern African States.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
This is to be done by promoting “outward-orientated” regional integration. The aims and objectives of COMESA,
as defined in the Treaty and its Protocols,1 is, therefore, to
facilitate the removal of the structural and institutional
weaknesses of member States so that they are able to
attain collective and sustained development.
sures implementation of the Monetary and Financial Co-operation programmes;
Among other things, COMESA member States have
agreed on the need to create and maintain:
—Intergovernmental Committee, a multi-disciplinary body composed of permanent secretaries
from the member States responsible for the development and management of programmes and
action plans in all the sectors of co-operation,
except in the finance and monetary sector;
D) A full free trade area guaranteeing the free movement of goods and services produced within COMESA
and the removal of all tariffs and non-tariff barriers;
—Technical Committees, responsible for the various economic sectors and for administrative and
budgetary matters;
(E) A customs union under which goods and services
imported from non-COMESA countries will attract an
agreed single tariff in all COMESA states;
—The Secretariat, to provide technical support and
advisory services to the member States in the implementation of the Treaty; and
(F) Free movement of capital and investment supported by the adoption of common investment practices so as
to create a more favourable investment climate for the
COMESA region;
—The Consultative Committee of the Business
Community and Other Interest Groups to provide
a link and facilitate dialogue between the business
community and other interest groups and organs
of the Common Market.
(G) A gradual establishment of a payment union based
on the COMESA Clearing House and the eventual establishment of a common monetary union with a common
currency; and
(H) The adoption of common visa arrangements, including the right of establishment leading eventually to
the free movement of ERQDILGH persons.
,QVWLWXWLRQDOVWUXFWXUHRI&20(6$
COMESA is made up of the following:
—The Authority of Heads of State and Government, the supreme Policy Organ of the Common
Market, responsible for general policy, direction
and control of the performance of the executive
functions of the Common Market and the
achievement of its aims and objectives;
—Council of Ministers, which takes policy decisions on the programmes and activities of
COMESA, including the monitoring and reviewing of its financial and administrative management;
—Court of Justice which has been established to ensure the proper interpretation and application of
the provisions of the Treaty and to adjudicate any
disputes that may arise among the member States
regarding the interpretation and application of the
provisions of the Treaty;
—Committee of Governors of Central Banks which
manages the COMESA Clearing House and en1
The following are the Protocols annexed to the Treaty:
1) Protocol on Transit Trade and Transit Facilities.
2) Protocol on Third Party Motor Vehicle Insurance Scheme.
3) Protocol Relating to the Unique Situation of Lesotho,
Namibia and Swaziland.
4) Protocol on the Rules of Origin for Products to be Traded
between COMESA Member States.
&20(6$¶6,QVWLWXWLRQDO/LQNDJHV
There are a number of other regional organisations in
operation within the region also covered by COMESA,
such as the East African Co-operation (EAC), Inter-Governmental Authority on Development (IGAD), Indian
Ocean Commission (IOC) and the Southern African
Development Community (SADC).
COMESA has excellent working relations both formally and informally with all of the regional organisations mentioned above. Memoranda of Understanding
have been signed with EAC and IGAD such that these
two organisations have agreed to adopt and implement the
COMESA trade liberalisation and facilitation programme. A similar Memorandum of Understanding is
also being formalised with the IOC.
Although these organisations also include as their aims
the promotion of regional co-operation and integration,
the COMESA Secretariat is neither in competition with
these organisations nor wishing to duplicate the efforts of
other organisations. COMESA sees its contribution to the
process of regional integration and regional economic development as being able to work together, and to cooperate fully, with its member States, other regional
bodies to which its member States are affiliated, and
donors and financial institutions and build upon the
achievements it has already made in its priority areas.
It is also true to say that the broad objectives of all of
the regional organisations are similar and largely complementary. They all endeavour to promote balanced economic development among their member States by,
among other things, harmonising their investment laws,
regulations and practices. All organisations aim to attain
Free Trade Areas among their membership and to liberalise the movement of capital by abolishing exchange controls. They also all aim to liberalise, for example, movement of persons through relaxation of visa requirements
and restrictions. While development goals and ambitions
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
are similar, strategies each sub-regional organisation
employ are different.
to bring together all the countries of the region into a
common regional integration agenda.
As is well known, the origins of SADC were in provision of donor support to develop infrastructure in the region which would allow the “front-line States” in the
apartheid era to function economically without being dependent upon South Africa. Owing to its origins, SADC
has adopted a sectoral approach to its development agenda. Member States have shared and assigned each other
economic sectors to co-ordinate. For example, Angola coordinates the Energy sector, Zambia the Mining Sector,
Zimbabwe Agriculture, Mozambique Telecommunications, Tanzania Commerce and Industry, and so on. To
generalise, SADC, therefore, has emphasised supply-side
interventions in its development approach, although on
can detect a different strategy being introduced, for example with the promotion of a free trade agenda.
The East African Co-operation (EAC), the Indian
Ocean Commission (IOC) and the Intergovernmental
Authority on Development (IGAD) are regarded by
COMESA as fast-track integration paths for the region.
All their membership, except for Somalia under IGAD,
are simultaneously members of COMESA. In a bid to
ease the movement of persons, the EAC has introduced a
common East African passport for nationals of Kenya,
Uganda and Tanzania.
COMESA, on the other hand, has traditionally placed
emphasis on demand-side measures. The philosophy of
COMESA is that the economic development of the subSaharan region will be largely dependent upon private
sector investment into the region. If this investment is to
be attracted into the region, the small countries of the region must be able to offer a large single market. There is,
therefore, an DSULRUL need to liberalise the trade and investment environment in the region as a whole to attract
the investment needed to address the supply-side of the
region’s economy. Hence, the COMESA agenda places
emphasis such issues as tariff reduction and elimination
of non-tariff barriers, streamlining documentation and
movement procedures for cargo and harmonising trade
documentation and enhancing the capacity of the private
sector to take advantage of opportunities arising from
regional as well as global integration.
It is apparent that though the conceptual approach may
vary between SADC and COMESA, their goal is common. In recognition of this fact, the Secretariats of the two
organisations are collaborating in the implementation of
various activities. Notable among these areas of collaboration are a review of Rules of Origin; adoption of a common customs document, and common customs bond
guarantee scheme; expansion of the COMESA third party
motor insurance scheme (the Yellow Card) to include
non-COMESA SADC members including South Africa;
and undertaking joint training programmes on WTO.
It is noteworthy that of the 14 SADC members, 10 are
also members of COMESA. This overlap in membership
has the advantage of co-ordinating the approaches of the
two organisations. For example, the various protocols of
SADC draw heavily on the COMESA Treaty and its protocols, which is neither controversial nor surprising. The
majority of SADC member States have been through the
process of drawing up a trade protocol (for example) under PTA/COMESA and would presumably not want to either “re-invent the wheel” or contradict previous agreements they drew up together when drawing up a protocol
on trade for SADC.
Similarly, 14 countries implementing liberalisation
measures under the Cross Border Initiative (CBI) are all
COMESA member States2. These measures are again
seen as ‘fast-track’ integration mechanisms for Eastern
and Southern Africa.
&20(6$
VWUDGHOLEHUDOLVDWLRQSURJUDPPH
The COMESA aims to establish a Free Trade Area
(FTA) by October 2000 through an annual reduction of
intra-COMESA tariffs. The timeframe for achieving a
Free Trade Area is as set out below.
The trade liberalisation programme gained momentum
and a higher leverage when PTA was transformed into the
Common Market for Eastern and Southern Africa
(COMESA) in 1994. COMESA agreed to new tariff reduction timeframe and schedule. COMESA further
agreed a uniform tariff reduction base of 60% as at October 1993—as a starting point.
&20(6$7DULII5HGXFWLRQ7LPHIUDPH
'DWH
Rate of Tariff
Reduction
2FWREHU
2FWREHU
2FWREHU
2FWREHU
60%
70%
80%
90%
100%
The programme of reducing intra-COMESA tariffs is
well advanced and is scheduled to be completed by the
year 2000. This will convert COMESA into a Free Trade
Area.
As at 31st May 1999, 3 countries had reduced tariffs by
90%, 7 by 80%, 1 by 70% and 3 by 60%, bringing the total
number of countries to have effected and published reduced COMESA tariffs by not less than 60% to 13. A further 2 countries have indicated that they will effect and
publish reduced COMESA tariffs in the near future. Two
(2) other countries have derogations up to the year 2000,
while another 2 are new members, having joined the
grouping in 1998. Only 2 countries have not published,
nor announced the intention to publish in the near future,
any tariff reductions according to the agreed timetable.
2
The existence of the regional organisations of
COMESA and SADC can therefore be viewed as an attempt by the common membership of both organisations
2FWREHU
Mozambique has recently expressed an interest in being a part of
the Cross Border Initiative and, as such, will presumably need to produce a Letter of CBI Policy to be endorsed by the co-sponsors which
will also, presumably, commit Mozambique to implementing 100% tariff reductions on intra-CBI trade by October 2000.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
While average national and MFN tariffs as of end of
May 1999, ranged from 8% to 60%, except for Egypt
whose average national tariff was higher, average tariffs
on COMESA-originating products ranged from 1% to
23% on the basis on the above reductions, again except
for Egypt whose average COMESA rate was still a little
higher. The overall average national tariff rate was in the
range of 25% compared to an overall average COMESA
tariff rate of less than 10%.
of trade in COMESA countries amongst themselves (intra-COMESA trade), with third countries and total
COMESA trade.
*URZWKRILQWUD&20(6$7UDGH
The effect on intra-regional trade of these tariff reductions and reductions in non-tariff barriers has been positive. In 1992, total intra-COMESA trade3 was estimated at
US$1.8 billion, trade with third countries at US$40.5 billion and total COMESA trade at US$42.3 billion.
The effect on intra-regional trade of these tariff reductions has been positive. The Table overleaf shows growth
& 20 (6$7U DGH 70
60
50
Q
R
LO
OL
%
6
8
40
30
20
10
0
T otal Ex po rts
Intra-C O M ESA
E xp orts
T ota l Im ports
Intr a- C O M E SA
Im po rt s
1997
Of the US$42.3 billion, imports accounted for
US$26.2 billion and exports US$16.1 billion giving a
negative trade balance for COMESA (then PTA) of
38.5% of export receipts.
T otal T rade
Intra-C O M E SA
T ra de
T ra de w i th 3rd
C ountri es
19 98
attributed in large part to the trade liberalisation measures
being implemented by member States.
Figure 22YHUDOO,QWUD&20(6$7UDGH
By 1996, though exports grew to US$22.0 billion, the
import bill had grown to just over US$35.2 billion, representing a negative trade balance equivalent to 37.5% of
COMESA exports. The small reduction in the relative
trade balance was partly due to the higher growth of exports compared to imports. Between 1992 and 1996, exports grew by an average of 7.2% per annum while imports grew by an average of 6.5% over the same period.
Intra-COMESA trade, on the other hand, grew by substantially higher margins. Between 1992 and 1996, intraCOMESA trade grew by an average of 13.6% per annum
while COMESA trade with third countries grew by an average of 6.1%, and total COMESA trade (intra- plus
extra-COMESA trade) grew by 6.5% per annum on average over the same period.
From 1996 through to 1998, intra-COMESA trade
grew even faster. In 1997, intra-COMESA trade grew by
8.45% while trade with third countries grew by only 2.3%
and total trade by 2.8%. In 1998, total trade grew 6.2%
while trade with third countries grew by 6%. IntraCOMESA trade, on the other hand went up by 10%. This
phenomenal growth of intra-COMESA trade can be
4,500
4,000
3,500
V
U
OD
O
R
'
3,000
6
8
I
R
V
Q
R
LO
OL
0
2,500
2,000
LQ
H
OX
D
9
1,500
1,000
500
1991
1992
1993
1994
1995
1996
1997
1998*
<HDU
Overall Intra-COMESA Trade
&20(6$&XVWRPV8QLRQ
The establishment of a FTA in COMESA by the year
2000 is a prelude to the establishment of a Customs
Union. The FTA is planned to operate for about 4 years
during which time all administrative, legal, institutional
3 Trade was conducted under PTA preferences.
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
and logistical preparations for the operation of the Customs Union are to be completed.
• Single load or drive axle = 10 tonnes
• Tandem axle group = 16 tonnes
COMESA member States have already committed
themselves to the implementation of a Common External
Tariff (CET) by the year 2004 of 0%, 5%, 15% and 30%
on capital goods, raw materials, intermediate goods and
final goods respectively.
Significant work has been undertaken, or is in the process of being implemented, on the design and implementation of a CET, all with financial and technical support
coming from the European Union. Notable among these
are:
• The COMESA Customs Document (COMESA-CD)
• Common Statistical Rules
• Common Tariff Nomenclature
• Institutional and Administrative Framework of a
Customs Union
7UDGHIDFLOLWDWLRQ
In the area of trade facilitation the COMESA Secretariat is implementing programmes to improve the transport and communications systems of the region as well as
improving information available to businessmen wishing
to trade both within the region and overseas.
+DUPRQLVHGURDGWUDQVLWFKDUJHV
The Road Transit Charges system was introduced in
1991 (currently being implemented by Burundi, Ethiopia,
Kenya, Malawi, Rwanda, Sudan, Uganda, Tanzania,4
Zambia and Zimbabwe) and specifies that heavy goods
trucks with more than 3 axles should pay a road charge of
US$10 per 100km; trucks with up to 3 axles should pay a
charge of US$6 per 100km; and buses with a capacity of
more than 25 passengers pay US$5 per 100km.
&20(6$FDUULHU¶VOLFHQVH
• Triple axle group = 24 tonnes
The maximum vehicle dimensions approved by the
COMESA Authority (and currently implemented by Malawi, Namibia, Swaziland, Zambia and Zimbabwe) are:
• 12.5m for a rigid chassis single vehicle or trailer;
• 17m for articulated trucks;
• 22m for truck and draw-bar trailer;
• 2.65 maximum width; and
• 4.60 maximum height.
&20(6$<HOORZ&DUG6FKHPH
The COMESA Yellow Card is a vehicle insurance
scheme which covers third-party liability and medical expenses, with a Yellow Card issued in one COMESA
country valid in all other countries participating in the
scheme. At present the scheme is operational in 12 countries (Burundi, DR Congo, Eritrea, Ethiopia, Kenya, Malawi, Rwanda, Swaziland, Tanzania, Uganda, Zambia and
Zimbabwe). The insurance industries of South Africa and
Namibia have expressed a wish to be part of the Yellow
Card scheme and consultations are in progress. At present
over 125 insurance companies are involved in the Yellow
Card scheme. Annually, about 41,000 Yellow Cards are
issued, a premium income of over US$2 million is collected and about 60 claims lodged. Within the last year a
Yellow Card re-insurance pool has been set up and plans
are underway to expand the scheme to Botswana, Lesotho
and Mozambique as well as the already mentioned countries of South Africa and Namibia.
&20(6$&XVWRPV%RQG*XDUDQWHH6FKHPH
The COMESA Carrier’s License allows commercial
goods vehicles to be licensed, with one license, which is
valid throughout the region so that the vehicles can operate in all member States. This means that vehicles can
pick up back-loads in other countries which makes more
efficient use of the region’s transport fleet so reduces the
cost of trade. The license was introduced in 1991 and is
currently in operation in 9 mainland countries (Burundi,
Kenya, Malawi, Rwanda, Swaziland, Tanzania, Uganda,
Zambia and Zimbabwe).
COMESA has also introduced a Customs Bond Guarantee Scheme, the objective of which is to eliminate the
avoidable administrative and financial costs that are associated with the current practice of nationally executed
customs bond guarantees for transit traffic. It has not yet
come into force but all member States have agreed to
ratify the scheme as soon as possible to eliminate the need
to open and close customs bond guarantees at each port of
entry. The introduction of the Bond Guarantee Scheme is
expected to release over US$200 million held in bonds at
any one time.
+DUPRQLVHGD[OHORDGLQJ
DQGPD[LPXPYHKLFOHGLPHQVLRQV
$GYDQFH&DUJR,QIRUPDWLRQ6\VWHP
• Axle load limits are:
• Single steering axle = 8 tonnes
4 The Harmonised Road Transit Charges are based on a Marginal
Cost Recovery system, although Tanzania has authority from Council
to apply a schedule which reflects Full Cost Recovery so has different
charges.
The Advance Cargo Information System (ACIS) is a
computer-based system, developed by UNCTAD. The
full ACIS suite of programmes consist of PortTracker,
RailTracker, RoadTracker and Lake Tracker. To date
UNCTAD, the main contractor, has developed and installed only RailTracker, which tracks cargo on the railway systems of Zambia Railways, Uganda Railways,
TAZARA, Kenya Railways and Tanzanian Railways.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
7HOHFRPPXQLFDWLRQVKDUPRQLVDWLRQ
A reliable, efficient and cost-effective regional telecommunications network would greatly facilitate economic integration in the region. It is recognised that the
existing network is not adequate to meet the needs of the
users and the current practice of routing regional telecoms
traffic via countries outside the region (mainly in Europe)
makes the implementation of competitive tariffs very difficult. To address this problem, COMESA has initiated
the establishment of a private, limited liability company
(COMTEL) which will build an asynchronous transmission mode (ATM) system which will link national systems together. While gateway to gateway infrastructure is
COMTEL’s priority, the national infrastructures are
equally important and there is a need for all countries in
COMESA to continue to develop and improve national
infrastructures.
COMTEL is to have a strategic partner who will hold
30 per cent of the equity of COMTEL, the rest being
owned by participating National Telecoms Operators
(25% of the equity)and private sector investors (45%
equity stake). The estimated investment cost is US$300
million.
,QIRUPDWLRQGLVVHPLQDWLRQ
The COMESA Secretariat is making use of recent advances in information technology to fulfil its role of providing commercially valuable information to the business
sector to enable them to take advantage of business opportunities emerging in the region. Specifically, the COMESA Secretariat has established a website on the Internet
(http://www.comesa.int) which is to be up-dated on a
regular basis and which is intended to be self-financing
(after the initial pilot period) and so will have to meet the
needs of the users for them, or advertisers, to be willing to
pay for this information. The website provides information on a country as well as a sector basis. It uses information from a number of sources, such as the in-house TINET and ASYCUDA databases (which have front-ends
attached to make them searchable) as well as information
from member States themselves (including Central Banks
and relevant Ministries) and other international sources.
)LQDQFLDODQG0RQHWDU\6\VWHPV
In the financial sector, COMESA has an ambitious harmonisation programme which is intended to lead to a
monetary union in the year 2025.
,QYHVWPHQW
COMESA countries in general have made good
progress in simplifying and liberalising investment approval processes and publishing of investment codes and
regulatory instruments. The Secretariat is in the process of
up-dating a 1991 study it did on trade and investment laws
in COMESA countries. The objectives of the study are to
provide information on trade and investment laws of
COMESA member States; create appropriate conditions
for the evaluation of a common approach to trade and investment in the region; and serve as a basis for the harmonisation of these laws. The study presents information in
six sections: Investment Laws; Taxation; Exchange Con-
trol; Financial services and Capital Markets; Trade Laws;
and Other Miscellaneous Laws.
COMESA is scheduled to become a Common Investment Area on the advent of the Free Trade Area in October 2000.
5HJLRQDOFRPSHWLWLRQSROLF\
COMESA is scheduled to become a Free Trade Area in
October 2000 and a Customs Union in 2004. The absence
of tariff and non-tariff barriers in an FTA enhances and
promotes competition. In order to ensure fair competition
and transparency among economic operators in the region, COMESA will formulate and implement a regional
competition policy. The policy shall be consistent with
internationally accepted practices and principles of competition especially the principles of the World Trade Organisation. Existing national competition policies shall be
harmonised and brought in line with the regional policy to
ensure consistency in regional policies, avoid contradictions and provide a regionally predictable economic environment.
The Treaty establishing COMESA provides, in Article 55, for fair competition within the region by prohibiting DQ\DJUHHPHQWEHWZHHQXQGHUWDNLQJVRUFRQFHUWHG
SUDFWLFHwhose objective or effect is the SUHYHQWLRQUH
VWULFWLRQRUGLVWRUWLRQRIFRPSHWLWLRQZLWKLQWKH&RPPRQ
0DUNHW
The treaty adequately provides for anti-dumping,
countervailing measures and safeguards in cases where
national economic development initiatives and programmes are in jeopardy. COMESA now working on ensuring that the provisions of the Articles relating to these
trade measures (Article 51—Dumping, Articles 52—54
Subsidies and Countervailing Duties, Article 55—Competition) are made operational. Article 51 paragraph 6, for
example, provides that a Member State may only institute
anti-dumping measures in conformity with regulations set
by Council. These regulations will be formulated as
COMESA becomes a Free Trade Area.
With regard to the resolution of trade-related disputes,
the COMESA Court of Justice shall play an important
role in interpreting the provisions of, and ensuring compliance with, the regional competition policy.
The proposed study will have the following terms of
reference:
• To compile all competition laws, regulations and
policies of each member State which aim at removing or lessening the concentration of economic
power into one firm or a group of firms;
• To catalogue all companies or businesses which
undertake activities likely to promote unfair trading
e.g. mergers, joint ventures, acquisitions, interlocking company directors for the purpose of gaining
unfair market share;
• Examine trade agreements among businesses and/or
governments that may lead to price fixing, collusion
tendering, dumping or the establishing of con-
1DWLRQDO6HPLQDURQ&RPSHWLWLRQ/DZDQG3ROLF\
glomerates for the purpose of undermining competition;
• Identify and assess institutional mechanisms in
member States that promote fair business practices.
• Document import and export business legislation
and practice to establish whether these promote the
concentration of economic power in a firm or a group
of firms;
It is envisaged that study shall be completed by early
next year, and implementation to follow immediately
thereafter.
&RPSHWLWLRQ3ROLF\7UDGHDQG'HYHORSPHQWLQWKH&RPPRQ0DUNHWIRU(DVWHUQDQG6RXWKHUQ$IULFD
$11(;
$YHUDJHQDWLRQDODQG&20(6$FXVWRPVWDULIIUDWHVDVDWHQGRI0D\
&RXQWU\
$YHUDJHQDWLRQDO
WDULIIUDWHV
&20(6$WDULII
UHGXFWLRQ
$YHUDJH&20(6$
WDULIIUDWHV
5DQN
1
Angola
124.67
C0
24.67
17
2
Burundi
135.40
60
14.16
13
3
Comoros
125.00
80
15.00
C7
4
Congo, DR
114.00
C0
14.00
12
5
Djibouti
124.50
C0
24.50
16
6
Eritrea
160.00
80
12.00
11
7
Egypt
367.00
90
36.70
19
8
Ethiopia
123.50
C0
23.50
15
9
Kenya
118.00
90
C1.80
C3
10
Madagascar
116.00
90
C1.60
C1
11
Malawi
116.25
70
C4.88
C6
12
Mauritius
130.00
80
C6.00
C8
13
Namibia
128.66
C0
28.66
18
14
Rwanda
138.33
60
15.33
14
15
Seychelles
-
-
-
-
16
Sudan
142.00
80
18.57
10
17
Swaziland
128.66
C0
28.66
18
18
Tanzania
119.00
80
13.80
C4
19
Uganda
118.75
80
11.75
C2
20
Zambia
111.25
60
14.50
15
21
Zimbabwe
135.30
80
17.06
19