Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
CTCF and Imprinting Disorder Preeti Misra Sang-Gook Han Contents Background Interesting Protein and Diseases •Gene Network •Epigenetic - Acetylation - Methylation •Loss of Imprinting •Properties of CTCF •Pathway - CTCF •Human diseases Background: Gene Network • Activation and Inhibition with evolution Control: Achieve an objective of the system Survival, reproduction U(t) + Y(t) + C(t) P(t) - H(t) Background: Epigenetic Epigenetic : Surface of genetic Gene expression control without modification of DNA sequence. Histone Modification –Acetylation –Methylation Expansion Condensation DNA Methylation - Methylation of Cystosine(C). - CpG island Background: Epigenetic DNA Methylation • Post-synthetic modifications of Chromatin structure • Cytosine-Guanine (CG) base pair is methylated. • Regulation in gene expression. Background: Loss of epigenetic marks. Background: Genomic Imprinting father mother DMR: Differentially Methylated Region ICR: Imprinting Control Region CTCF Protein • Gene location: 16q22 • 11 zinc fingers. • Transcription Binding Factor : (MYC, PLK, PIM-1, p19ARF, and Igf2/H19, APPβ,β-globin, and lysozyme regulatory sequences ) • • • • • Binding to TFBSs including ICR and CpG island. Cis-regulartory. Regulation of DNA methylation pattern Highly conserved. There are 39,622 ZnFg registered in pFam CTCF motif CTCF Structure Classification and GO CTCF Protein : C2H2 type C - x(2,4) - C - x(3) - [LIVMFYWC] - x(8) - H - x(3,5) – H GSSGSSGRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCS KCGKTFTRRNTMARHADNCAGPDGVEGENSGPSSG CTCF and its Uses • CTCF is involved in the control of cell growth and differentiation. • Involved in IGF2 imprinting regulation. • CTCF may represent a novel tumor suppressor gene that displays tumor-specific "change of function" rather than complete "loss of function“. • CTCF may establishes a regulatable epigenetic switch for X-inactivation Human Disease: Beckwith-Wiedemann syndrome BWS locus: 11p15.5 BWS occurs in 1:13,700 Phenotypes: 1. Macroglossia: Problem with Eating, Breathing, speaking 2. Abdominal wall defects 3. Fast growth: birth weight and height (above mean) enlarge internal organs (kidneys, liver,pancreas) hemihyperplasia 4. Ear lobe Pathway : BWS Wilms’ Tumor BWS Tumor CTCF Inhibit the enhancer from activating IGF2(Insulin-like Growth Factor 2) and causes H19 to be expressed. Mutation ZF3 ZF3 ZF3 ZF7 Other Diseases • Prader-Willis Syndrome(PWS)-failure to thrive during infancy and hyperphagia. • Angelman syndrome(AS)- mental retardation and speech impairment • Transient neonatal diabetes mellitis(TNDM)-a rare form of diabetes • Alpha-thalassemiaoccurs(males)- mental retardation syndrome. Capta Capta Catpa Reference • http://www.benbest.com/health/cancer.html • http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Gr aphics&list_uids=10664 • Marcus Vinicius de Matos Gomes; Ester Silveira Ramos (2003), BeckwithWiedemann syndrome and isolated hemihyperplasia, Sao Paulo Med J. 21, 133138 • Keith D. Robertson (2004), DNA Methylation and Human Disease, Nature, 6, 597-610 • Galina N. Filippova, et. al. (2002), Tumor-associated Zinc Finger Mutations in the CTCF Transcription Factor Selectively Alter Its DNA-binding Specificity, Cancer Research, 62, 48-52 Question Time!!!!