Survey
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
Supplementary data Supplementary methods Plasmids All genes were cloned into an overexpressing plasmid using a two-step strategy. bll2757 (fixK2), bll4943 (clpX), bll4944 (clpP1), bll5153 (clpA), bll5154 (clpS1) and, blr6518 (sspB) were amplified by PCR from wild-type B. japonicum genomic DNA with primers listed in Table S3. GFP proteins used in this study harbor two point mutations in the chromophore (F64L S65T). All GFP derivatives were generated by PCR using the primers listed in Table S3. PCR fragments were cloned first in the pGEM-T easy vector, digested with the respective enzymes (Table S3) and ligated into a T7-based overexpressing plasmid. clpA was cloned into pET16, clpS1, all gfp derivatives (GFP, GFPssrABj, GFPcA12, Fn9-GFP, GFP-Fc12, Fn9-GFPFc12) and clpP1 were cloned into pET24. As annotated in Rhizobase (http://genome.kazusa.or.jp/rhizobase/), ClpS1 from B. japonicum is 130 amino acids in length, and contrary to all other rhizobia, it possesses a non-conserved N-terminal extension of 20 amino acids. Since we failed to overexpress the full-length protein in E. coli, we cloned and overexpressed a shorter version lacking these first 20 amino acids. Curiously, ClpS 1 has a second methionine in frame at position 21, which might be encoded by an alternative start codon. All experiments were done with this shorter version of the predicted ClpS1. ClpP1 was fused to a tobacco etch virus (TEV) recognition site and a His6-tag at its C-terminus. clpX and sspBα were both cloned into pProEx-HTb with an N-terminal His6-tag followed by a TEV recognition site. fixK2 was C-terminally fused to the Intein-Chitin Binding Domain tag in pTXB1. All DNA sequences were confirmed by sequencing. Protein overexpression and purification All proteins were overexpressed in BL21 (DE3) cells from bacteriophage T7 promoterbased plasmids. ClpA, ClpS1 and all GFP derivatives were purified as previously described for 1 E. coli orthologs [1-2]. SspBα, ClpX and ClpP1 were purified over a Ni-NTA column (Qiagen) and the His6-tag was cleaved off using the TEV protease. The tag-cleaved, TEV-free ClpX was further purified on a Resource Q column (GE Healthcare) and eluted with 50 mM HEPES KOH pH 7.5, 300 mM KCl, 10% glycerol, 2 mM EDTA. All proteins were stored in buffer S (50 mM HEPES KOH pH 7.5, 300 mM KCl, 15% glycerol, 2 mM EDTA). ClpP 1 was also further purified over a Q Sepharose column (GE Healthcare) and eluted with 50 mM Tris HCl pH 7.5, 300 mM KCl, 10% glycerol, 2 mM EDTA and was subsequently loaded onto a Superdex 200 10/30 HR column equilibrated with buffer S at pH 8 with 20% glycerol. FixK2 was purified with the IMPACT (intein-mediated purification with an affinity chitin-binding tag) system (NEB). This purification procedure has the advantage to generate a protein without additional vector-encoded amino acids, allowing us to generate a homogeneous protein sample without additional amino acid extensions potentially masking a recognition site of the protease. The purified tag-free FixK2 protein was stored in 50 mM HEPES KOH pH 7.2, 150 mM KCl, 0.1 mM EDTA. The correct molecular weight of each protein was confirmed by mass spectrometry. Enzymatic assays ClpA and ClpX ATPase activity ATPase activity was measured in a continuous spectrophotometric ATPase assay at 25 °C as previously described [3]. All reactions were performed in buffer S supplemented with 1 mM DTT, 20 mM MgCl2 and 5 mM ATP in a Cary UV-visible spectrophotometer (Varian). ClpP peptidase assay 0.1 µM ClpP1 was incubated with 0.1 to 4 mM Suc-LY-AMC (Sigma Aldrich) at 25 °C in buffer S with 20 mM MgCl2, 1 mM DTT and 11% DMSO. Substrate degradation was recorded in a 96-well plate using a Victor3 fluorimeter (Perkin Elmer) with an excitation and emission 2 wavelength set at 380 nm and 460 nm, respectively. Initial slopes were recorded and analyzed according to Michaelis-Menten theory. 3 Table S1. Compilation of genes coding for ClpA, ClpX, ClpP, ClpS, and SspB orthologs in rhizobiaa. Rhizobiaa ClpA ClpX ClpP ClpS SspB B. japonicum USDA110 bll5153 bll4943 blr0611 bll2636 blr6518 bll4944 bll5154 mlr0748 mll0664 mlr8472 mll2736 SMc01903 SMc02110 SMc02720 SMc02694 Mesorhizobium loti mll0663 mlr8474 MAFF303099 Sinorhizobium meliloti 1021 SMc02109 SMc01904 mlr1474 SMc01450 SMc03841 Rhizobium etli CFN42 RHE_CH01907 RHE_CH01588 RHE_CH01414 RHE_CH01906 RHE_CH01587 RHE_CH03030 RHE_CH02800 RHE_CH03069 Rhizobium leguminosarum RL2213 RL1689 bv. viciae 3841 RL1170 RL2212 RL1688 RL3476 RL3257 RL3515 Bradyrhizobium sp. BTAi1 BBta_4772 BBta_4571 BBta_4573 BBta_2472 BBta_6105 BBta_4773 Bradyrhizobium sp. ORS278 Rhizobium sp. NGR234 Azorhizobium caulinodans BRADO4545 NGR_c13260 AZC_1595 BRADO4197 NGR_c10350 AZC_1609 BRADO0526 BRADO2155 BRADO4198 BRADO4546 NGR_c10340 NGR_c13250 NGR_c23470 NGR_c23260 AZC_1608 AZC_1594 BRADO5583 NGR_c20590 AZC_4485 ORS571 a Mutualistic symbiotic rhizobia whose genome sequences have been deposited in the Rhizobase (http://genome.kazusa.or.jp/rhizobase/) as of September 2012, and contain at least an annotated FixK-coding gene. Blast searches were done using blastp tool in the Rhizobase (http://genome.microbedb.jp/blast/blast_search/rhizobase/genes) and E. coli K12 orthologs as query sequences (http://www.ecogene.org/3.0/). In the case of SspB, C. crescentus CC_2102 (Q9A6J2; [4]) was used as query. 4 Table S2. Expression data of clp genes at transcriptomic and proteomic levels. Sequence identity with E. coli proteinsb Sequence identity with C. crescentus proteinsc Oxic blr0611 ClpP2 58 % 66% 308 ± 41 bll2636 ClpS2 43 % 39% 507 ± 99 959 ± 206 248 ± 72 bll4943 ClpX 73 % 84% 5208 ± 770 6838 ± 1022 5564 ± 507 4180 ± 981 64 bll4944 ClpP1 65 % 73% 4841 ± 595 5441 ± 1196 4573 ± 812 1551 ± 345 42 bll5153 ClpA 58 % 73% 4821 ± 526 9567 ± 2351 4628 ± 620 4706 ± 1238 64 bll5154 ClpS1 57 % 68% 3349 ± 852 5700 ± 2899 3553 ± 571 3082 ± 1052 2 28 % 44% 1551 ± 167 1319 ± 574 1491 ± 267 853 ± 214 2 Genea Protein blr6518 SspBα Transcriptomicd Microoxic a 201 ± 89 Anoxic 244 ± 41 Proteomice Symbiosis 231 ± 104 335 ± 65 Symbiosis - Gene nomenclature according to Kaneko et al. [5]. Sequence identity of B. japonicum USDA110 Clp proteins and E. coli K12 orthologs (http://www.ecogene.org/3.0/): ClpX (P0A6H1), ClpP (P0A6G7), ClpA (P0ABH9), ClpS (P0A8Q6), SspB (P0AFZ3). Blast searches were performed by using blastp (http://www.ncbi.nlm.nih.gov/BLAST/Blast.cgi?PAGE=Proteins). c Sequence identity of B. japonicum USDA110 Clp proteins and C. crescentus CB15 orthologs (http://cmr.jcvi.org/cgibin/CMR/GenomePage.cgi?org=gcc): ClpX (P0CAU2), ClpP (P0CAU1), ClpA (Q9A5H9), ClpS (Q9A5I0), SspBα (Q9A6J2). d Average and standard deviation of normalized signal intensities detected in the transcriptomic experiments of cells grown under free-living conditions (oxically, microoxically, anoxically) and in soybean nodules (symbiosis) [6-7]. e Number of spectra for the corresponding protein detected in bacteroids isolated from soybean nodules in a proteomic approach [8]. b 5 Table S3. List of proteins used in this study and primers used for amplification of their genes. The protein names refer to the protein overexpressed and not the final protein. Restriction enzyme sites are underlined in the primer sequence, additional sequences (tags or amino acids) are in bold. For: forward primer; Rev: reverse primer; TEV: tobacco etch virus recognition sequence; CBD: Chitin Binding Domain; cA12: 12 C-terminal amino acids of ClpA; Fn9: 9 N-terminal amino acids of FixK2; Fc12: 12 Cterminal amino acids of FixK2. Protein Plasmid backbone Restriction sites Primers (5’-3’) ClpA pET16a NcoI, NdeI For: CTGAGCCCATGGCGACTTTTTCTCAAAGC Rev: CGGGTTCATATGTCAAGCCTTGACCAG ClpS1ΔN20 pET24a NdeI, NotI For: GCGCATATGAGCAACGACGAGAACCG Rev: CCGCGGCCGCCTTATTTCTTTTCCATCAC His6-TEV-ClpX pProEx-HTbb NdeI, BamHI For: GCATGCCATATGAGTAAGGTCGGCACGA Rev: ACATCGGGATCCCTAGTTCAGGCGCTGGCGTTCTC ClpP1-TEV-His6 pET24a For: GATAATCATATGCGCGATCCGGTTGAAACCTAC NdeI, BamHI Rev: ACACGGGATCCCTAGTGGTGGTGGTGGTGGTGAGACTGGAAGTA CAGGTTTTCCTGGGTCTTCGCCGCGGCCGGCTCT His6-TEV-SspBα pProEx-HTbb NdeI, EcoRI For: GCATGCCATATGGCGACCGATCATATCCGATAC Rev: GCGAATTCTGGCCATGAGCACATCCATTCC NdeI, SpeI For: GCGCATATGCTGACCCAGACAC Rev: ACTAGTGCATCTCCCGTGATGCAGGCGTCGAGATTGTGCAGGC For: GCGGCTAGCATGAGTAAAGGAGAAGAAC Rev: CGCGAATTCTCATTTGTATAGTTCATCCATGCCATGTG FixK2-Intein-CBD pTXB1c GFP pET24a NheI, EcoRI GFPssrABj pET24a For: GCGGCTAGCATGAGTAAAGGAGAAGAAC NheI, EcoRI Rev: CGAATTCTCACGCGGCCTGCGCCACCGGCGCAAAGTTATCGTTT GCTGCTTTGTATAGTTCATCCATGCCATG GFP-cA12 pET24a For: GCGGCTAGCATGAGTAAAGGAGAAGAAC NheI, HindIII Rev: CGAAGCTTTCAAGCCTTGACCAGCGGCCCCTTGGAGGTCGGCCC CTTTTTGTATAGTTCATCCATGCCATG Fn9-GFP pET24a For: GCGCTAGCATGCTGACCCAGACACTCAAGACCCAGAGTAAAGGA NheI, EcoRI GAAGAACTTTTCACTGGGGTTG Rev: CGCGAATTCTCATTTGTATAGTTCATCCATGCCATGTG GFP-Fc12 pET24a For: GCGGCTAGCATGAGTAAAGGAGAAGAAC NheI, EcoRI Rev: GCGAATTCTCAGGCGTCGAGATTGTGCAGGCGCTGGCGGTTGC GCAGTTTGTATAGTTCATCCATGCCATGTG Fn9-GFP-Fc12 pET24a NheI, EcoRI For: GCGCTAGCATGCTGACCCAGACACTCAAGACCCAGAGTAAAGGA GAAGAACTTTTCACTGGGGTTG Rev: GCGAATTCTCAGGCGTCGAGATTGTGCAGGCGCTGGCGGTTGC GCAGTTTGTATAGTTCATCCATGCCATGTG a Novagen Invitrogen c New England Biolabs b 6 A. Zn finger ClpXEc ClpXCc ClpXBj MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCNDIIREEIKEVAPHRE 60 MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHK-IAFVKS 59 MSKVGTSDSKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREENK-SSLVKS 59 *:. ...: . ********************:*:******:** ****** * : :. ClpXEc ClpXCc ClpXBj RSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDTSNGVELGKSNILLIGP 120 KDGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGP 119 RDGIPTPKEICKVLDDYVIGQSHAKKVLSVAVHNHYKRLNHQTKHNDVELAKSNILLIGP 119 :..:***:** : ******** :*****:***:******.: . *.***.******:** D2 domain Walker A ClpXEc ClpXCc ClpXBj D2 domain TGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVQKAQRGI 180 TGTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGI 179 TGSGKTLLAQTLARILDVPFTMADATTLTEAGYVGEDVENIILKLLQAADYNVERAQRGI 179 **:******:****::*************************: **** .**:*::***** Walker B D2 domain ClpXEc ClpXCc ClpXBj VYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQEFLQVDT 240 VYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDT 239 VYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDT 239 *********************************::*****:******************* ClpXEc ClpXCc ClpXBj SKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKASEGELLAQVEPEDLIKFGL 300 TNILFICGGAFAGLEKIISARGAAKS-IGFGAKVTDPEERRT-GEILRNVEPDDLQRFGL 297 TNILFICGGAFAGLEKIISARGRSTS-IGFGAQVLAPEDRRT-GEIFRHVEPEDLLKYGL 297 ::************:*:** * : * ***** * .:: : **:: :***:** ::** ClpXEc ClpXCc ClpXBj IPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQALFNLEGVDLEFRDEALDAIAK 360 IPEFIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAK 357 IPEFVGRLPVVATLEDLDETSLKKILTEPKNALVKQYQRLFEMENIELTFADEALGAVAR 357 ****:*********::*.* :* :**.*****:.**** **::*.: * * ::** :*: ClpXEc ClpXCc ClpXBj KAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVIDESVIDGQSKPLLIYGKPEAQQ 420 KAIARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGA 417 KAIERKTGARGLRSILEAILLETMFDLPGLEGVEEVVISREVVEGTARPLYIYADRSDRA 417 **: ***********:*. **:**::** *.**:**:. .*::* ::** **.. . ClpXEc ClpXCc ClpXBj ASGE-- 424 ASA--- 420 VENASA 423 .. D2 domain ClpP loop 7 B. ClpS binding region ClpAEc ClpACc ClpABj --MLNQELELSLNMAFARAREHRHEFMTVEHLLLALLSNPSAREALEACSVDLVALRQEL 58 MPSFSRPLEESLHRAVAYANQRKHEYATLEHLLLSLTDDEDAAGVMRACDVDLAALKKSL 60 MPTFSQSLEQSLHRALAIANERHHQYATLEHLLLSLIDDSDAAAVMRACSVDLDKLRTSL 60 :.: ** **: *.* *.:::*:: *:*****:* .: .* .:.**.*** *: .* ClpAEc ClpACc ClpABj EAFIEQTTPVLPASEEERDTQPTLSFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQES 118 SNYLDVELTSLVVDDEE-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLVAIFSERES 119 VNYLETEFENLVTDGAD-DAKPTAGFQRVIQRAVIHVQSSGREEVTGANVLIAIFAERES 119 ::: * .. : *::** .****:****:*******:********:***:*:** ClpAEc ClpACc ClpABj QAAYLLRKHEVSRLDVVNFISHGTRK----DEPTQSSDPGSQPNSEEQAG-------GEE 167 HAAYFLQEQDMTRYDAVNFIAHGIAKKAGASEPKSVKGASTGSNATEEDGDKSTTKTGGE 179 HAAYFLQEQDMTRYDAVNYISHGIAKRPGVSEARPVRGVDEETETKGSD----DAKKKGE 175 :***:*::::::* *.**:*:** * .*. . . .:: . * ClpAEc ClpACc ClpABj RMENFTTNLNQLARVGGIDPLIGREKELERAIQVLCRRRKNNPLLVGESGVGKTAIAEGL 227 ALEAYCVDLNEKARQGKVDPLIGRANEVERAIQILCRRTKNNPLLVGDPGVGKTAIAEGL 239 ALETYCVNLNKKARDGKIDPVIGRNSEINRAIQVLCRRQKNNPLFVGEAGVGKTAIAEGL 235 :* : .:**: ** * :**:*** .*::****:**** *****:**:.*********** ClpAEc ClpACc ClpABj AWRIVQGDVPEVMADCTIYSLDIGSLLAGTKYRGDFEKRFKALLKQLEQDTNSILFIDEI 287 ARKIVTHQVPEVLEGATIYSLDMGALLAGTRYRGDFEERLKQVVKELENHPNAVLFIDEI 299 AKRIVDSEVPEVLAAATVFSLDMGTLLAGTRYRGDFEERLKQVLKELEAHPNAILFIDEI 295 * :** :****: .*::***:*:*****:******:*:* ::*:** ..*::****** ClpAEc ClpACc ClpABj HTIIGAGAASGGQVDAANLIKPLLSSGKIRVIGSTTYQEFSNIFEKDRALARRFQKIDIT 347 HTVIGAGATSGGAMDASNLLKPALASGTLRCMGSTTYKEFRQHFEKDRALVRRFQKIDVN 359 HTVIGAGATSGGAMDASNLLKPALASGTIRCMGSTTYKEYRQHFEKDRALVRRFQKIDIN 355 **:*****:*** :**:**:** *:**.:* :*****:*: : *******.*******:. ClpAEc ClpACc ClpABj EPSIEETVQIINGLKPKYEAHHDVRYTAKAVRAAVELAVKYINDRHLPDKAIDVIDEAGA 407 EPTVEDTIKILKGLKTYYEDFHKLKYTADALKVAVELSAKYITDRKLPDKAIDVIDEAGA 419 EPTVEDAIAILKGLKPYFEDYHRLKYTNEAIEAAVQLSSRYIHDRKLPDKAIDVIDESGA 415 **::*::: *::***. :* .* ::** .*:..**:*: :** **:***********:** ClpAEc ClpACc ClpABj RARLMPVSKRKKTVNVADIESVVARIARIPEKSVSQSDRDTLKNLGDRLKMLVFGQDKAI 467 SQMLLPESRRKKTIGVKEIESVVAKIARIPPKSVSKSDTEALKELESDLKRAVFGQDEAL 479 AQMLVAENKRKKTIGIKEIETTIASMARIPPKSVSKDDAEVLKHLEQTLKRTVFGQDKAI 475 *:. .:****:.: :**:.:* :**** ****:.* :.**.* . ** *****:*: ClpAEc ClpACc ClpABj EALTEAIKMARAGLGHEHKPVGSFLFAGPTGVGKTEVTVQLSKALGIELLRFDMSEYMER 527 SQLAAAMKLARAGLREPNKPIGSYLFSGPTGVGKTEAAKQLAQTLGIEMLRFDMSEYMER 539 ESLAASIKLARAGLREPEKPIGCYLFSGPTGVGKTEVAKQLAASLGVELLRFDMSEYMER 535 . *: ::*:***** . .**:*.:**:*********.: **: :**:*:*********** ClpS binding region N-domain Linker D1 domain Walker A D1 domain Walker B D1 domain D1 domain D1 domain D2 domain D2 domain Walker A 8 D2 domain Walker B ClpAEc ClpACc ClpABj HTVSRLIGAPPGYVGFDQGGLLTDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLT 587 HTVSRLIGAPPGYVGFDQGGQLTDAVDQHPHAVVLLDEIEKAHGDVYNILLQVMDNGTLT 599 HTVSRLIGAPPGYVGFDQGGLLTDGVDQHPHCVVLLDEIEKAHPDLYNVLLQIMDHGRLT 595 ******************** ***.* :***.*:********* *::*:***:**:* ** ClpAEc ClpACc ClpABj DNNGRKADFRNVVLVMTTNAGVRETERKSIGLIHQDNSTDAMEEIKKIFTPEFRNRLDNI 647 DSNGKKVDFRNVVLIMTTNAGASDAQRNSIGFGRSKVEGEEEAALKRLFTPEFRNRLDAV 659 DHNGKQVNFRNVILIMTTNAGASDLAKQAFGFTRSKREGDDHEAINRQFAPEFRNRLDAI 655 * **::.:****:*:******. : ::::*: :.. . : ::: *:******** : ClpAEc ClpACc ClpABj IWFDHLSTDVIHQVVDKFIVELQVQLDQKGVSLEVSQEARNWLAEKGYDRAMGARPMARV 707 VAFKPLSADIIRQVVQKFVMQLEAQLADRNITIELSDDAADWLAKNGFDELYGARPLARV 719 VSFSHLSVEVIGTVVEKFVLQLEAQLGDRDVTIELSEPAKAWLVQHGYDEQMGARPMARV 715 : *. **.::* **:**:::*:.** ::.:::*:*: * **.::*:*. ****:*** ClpAEc ClpACc ClpABj IQDNLKKPLANELLFGSLVDGGQVTVALD-------KEKNELT-YGFQSAQK-------- 751 IQEHIKKPLADDILFGRLVRGGHVKVVLK-------DSKIDFE-IDSSTAPKA------- 764 IQEHIKKPLADEVLFGKLKSGGHVRVVLVKDEADETKEKIGFEFVEGPVTPKQEKLPGAR 775 **:::*****:::*** * **:* *.* ..* : : * ClpAEc ClpACc ClpABj -------HKAEAAH------------- 758 ----GKTDETEPAMAE----------- 776 KRPPGKPKPGGPGGSKGPTSKGPLVKA 802 . .. D2 domain ClpP loop Autodegradation tag 9 C. Axial loop ClpPEc ClpPCc ClpP1Bj ClpP2Bj MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQ M-----YDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQ M-----RDPVETYMNLVPMVVEQTNRGERAYDIFSRLLKERIIFLTGPVEDGMSTLVVAQ M-----RD----MLQLVPMVVEQSARGERSFDIYSRLLRERIIFLNGEVNDAMSGLVCAQ * * : *****:**: ****::**:****:**:***.* *:* *: *: ** ClpPEc ClpPCc ClpP1Bj ClpP2Bj Δ Δ Δ ● MLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTICMGQAASMGAFLLTAG LLFLESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAG LLFLEAENPKKEISMYINSPGGVVTSGLAIYDTMQFIRPPVSTLCTGQAASMGSLLLAAG LLFLEAENPNRPINLYINSYGGVVTSGLAMYDTMQFIKAPVHTLCMGTARSMGSFLLMAG :****:***:: * :**** ***:*:*:::*****:*:. * *:* * * ***::** ** ClpPEc ClpPCc ClpP1Bj ClpP2Bj ClpPEc ClpPCc ClpP1Bj ClpP2Bj ● Handle region AKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIER AAGQRISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVER EKDMRFSLPNARIMVHQPSGGFQGQATDIMLHAQEILNLKKRLNEIYVKHTGQTYKTIED ERGHRAALPNASLHVHQPLGGFQGQASDILIHANEMQETKRRITRLYAQHCGRTEAEVER . * .***: : :*** **::***:** **.:: : * *:..: . * *:: :* ● DTERDRFLSAPEAVEYGLVDSILTHRN--------- 207 TLDRDHFMSADEAKAWGLVDHVYDSRDAAEAGAE-- 209 ALERDKFLTANDAKEFGLVDRVIDKRAEEPAAAKTQ 211 TLDRDHFMTAQQGVEWGLIDRVFAERDAT------- 200 :**:*::* :. :**:* : * 60 55 55 51 120 115 115 111 180 175 175 171 D. ClpSEc ClpSCc ClpS1Bj ClpS2Bj M----GKTND---------WLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVL MICPPGENKSMAERKQGGQGNGVGSSVVTEVKPKTQKPSLYRVLILNDDYTPMEFVVYVL --MSNDENRS-------GSPTGPNTSVITKVKPKTKRPNLYRVLILNDDYTPMEFVVHVL ----------MND---------AVTKPKTRTKTKVERPKLHKVILINDDYTPREFVTMIL ..: : *.:::*:::****** *** :* ClpSEc ClpSCc ClpS1Bj ClpS2Bj QKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKAERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKDEKFFQKDVEAATKIMLHVHHHGIGECGVFTYEIAETKVTQVMDFARKHQHPLQCVMEKKKAEFRMTEDQAYKVMITAHKLGACVVAVFTRDVAETKATRATDAGRAKGYPLLFTTEPEE : * : * ::*: .* * .*:* ::****.: . . .* : :** . * 47 60 51 41 ClpA binding region 10 106 119 110 101 E. Substrate binding SspBEc SspBαCc SspBαBj M-------DLSQLTPRRPYLLRAFYEWLLDNQLTP---------HLVVDVTLPGVQVPME 44 MSQTEPPEDLMQYEAMAQDALRGVVKAALKKAAAPGGLPEPHHLYITFKTKAAGVSGPQD 60 MAT-----DHIRYDVLARDALRGVLRKVLTDAASHG-LPGEHHFFITFVSKAEGVKLSSR 54 * * : **.. . * . : .:.. . **. . SspBEc SspBαCc SspBαBj ----YARDGQIVLNIAPRAVGNLELANDEVRFNA--RFGGIPRQVSVPLAAVLAIYAREN 98 LLSKYPDEMTIVLQHQ-----YWDLAPGETFFSVTLKFGGQPKRLSVPYAALTRFYDPSV 115 LLAQYPEEMTIILQHQ-----FWDLTVLEDRFEVGLSFGGIPERLVVPFSAIKSFLDPSV 109 *. : *:*: :*: * *.. *** *.:: ** :*: : . Substrate binding Substrate binding SspBEc SspBαCc SspBαBj Linker ClpX binding GAGTMFEPEAAYDEDTSIMNDEEASADNETVMSVIDGDKPDHDDDTHPDDEPPQPPRGGR 158 QFALQFSAP----EIIEDEPE-----PDP----E----PEDKANQGASGDE-------GP 151 KFGLQFDTS----DVAEVAPETLPAAPAPSALSV----PTPATDKAETAEEPTPPSQGGA 161 . *.. : . : :. . :* * ClpX binding SspBEc SspBαCc SspBαBj PALRVVK---- 165 KIVSLDQFRKK 162 EVVRLDRFRKK 172 : : : Fig. S1. Alignment of Clp proteins from E. coli, C. crescentus and B. japonicum. Alignment was performed with T-Coffee using the Clustalw-pairwise method (http://www.igs.cnrs- mrs.fr/Tcoffee/tcoffee_cgi/index.cgi?stage1=1&daction=TCOFFEE::Advanced; [9]). The main features known for E. coli proteins are annotated above the sequences: the Walker A and Walker B motifs are underlined [10] and the ClpP loop is marked as bold in ClpX and ClpA sequences [11]. The vertical bar represents the propetide cleavage in ClpP [12]. Note that the site of the propeptide cleavage is a prediction for C. crescentus. Rond circle: catalytic triad of the ClpP protein [13-14]. Empty triangle: hydrophobic patch of ClpP making contact with the ClpP loop of the chaperone ClpA or ClpX [14]. Boxed amino acids: key residues involved in ClpA/ClpS interaction [15]. Other amino acids important for ClpS interaction are marked with grey shade in ClpA alignment [16]. Amino acids in bold and marked with an arrow in ClpS alignment represent the residues involved in N-end residue contact [1718]. Star represents identical amino acids, colon conserved substitutions and dot semi-conserved substitutions. Ec: E. coli K12; Cc: C. crescentus CB15; Bj: B. japonicum USDA110. 11 Fig. S2. B. japonicum ClpP1 is N-terminally processed. The molecular mass detected by mass spectrometric analysis of purified protein corresponds to the mature protein with the nine N-terminal amino acids being cleaved off plus a C-terminal tag (ENLYFQ), which remains after cleavage with TEV protease. The sample was desalted and analyzed by ESI-MS. The m/z data were then deconvoluted into MS-data using the MaxEnt1 software. 12 Fig. S3. ClpA is autodegraded in the absence of substrate by recognition of its C-terminal region. ClpA autodegradation by ClpAP1 followed on Blue Coomassie-stained SDS-PAGE in the absence (A, upper panel) or presence (A, bottom panel) of ClpS1. (B) Degradation of GFP protein fused with the 12 Cterminal amino acids of ClpA (GFP-cA12) in the absence or presence of ClpS1 was followed by fluorescence. (C) Alignment of the C-terminal twelve residues of ClpA from B. japonicum (Bj), Neisseria gonorroehae (Ns), E. coli (Ec), Myxococcus xanthus (Mx), and Helicobacter pylori (Hp). Alignment was performed with T-Coffee using the Clustalw-pairwise method [9]. Fig. S4. Comparison of degradation rates of Fn9-GFP-Fc12 with that of FixK2 by ClpAP1. The degradation was followed by Blue Coomassie-stained SDS-PAGE and quantified with AlphaImager. Results are the means ± standard deviations (error bars) of at least 3 independent experiments. 13 References [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [13] [14] [15] [16] [17] [18] Dougan, D.A., Reid, B.G., Horwich, A.L. and Bukau, B. (2002). ClpS, a substrate modulator of the ClpAP machine. Mol. Cell. 9, 673-683. Weber-Ban, E.U., Reid, B.G., Miranker, A.D. and Horwich, A.L. (1999). Global unfolding of a substrate protein by the Hsp100 chaperone ClpA. Nature 401, 90-93. Rieger, C.E., Lee, J. and Turnbull, J.L. (1997). A continuous spectrophotometric assay for aspartate transcarbamylase and ATPases. Anal. Biochem. 246, 86-95. Lessner, F.H., Venters, B.J. and Keiler, K.C. (2007). Proteolytic adaptor for transfermessenger RNA-tagged proteins from alpha-proteobacteria. J. Bacteriol. 189, 272-275. Kaneko, T. et al. (2002). Complete genomic sequence of nitrogen-fixing symbiotic bacterium Bradyrhizobium japonicum USDA110. DNA Res. 9, 189-197. Hauser, F., Pessi, G., Friberg, M., Weber, C., Rusca, N., Lindemann, A., Fischer, H.M. and Hennecke, H. (2007). Dissection of the Bradyrhizobium japonicum NifA+ regulon, and identification of a ferredoxin gene (fdxN) for symbiotic nitrogen fixation. Mol. Genet. Genomics 278, 255-271. Pessi, G., Ahrens, C.H., Rehrauer, H., Lindemann, A., Hauser, F., Fischer, H.M. and Hennecke, H. (2007). Genome-wide transcript analysis of Bradyrhizobium japonicum bacteroids in soybean root nodules. Mol. Plant-Microbe Interact. 20, 1353-1363. Delmotte, N. et al. (2010). An integrated proteomics and transcriptomics reference data set provides new insights into the Bradyrhizobium japonicum bacteroid metabolism in soybean root nodules. Proteomics 10, 1391-1400. Notredame, C., Higgins, D.G. and Heringa, J. (2000). T-Coffee: A novel method for fast and accurate multiple sequence alignment. J. Mol. Biol. 302, 205-217. Dougan, D.A., Mogk, A., Zeth, K., Turgay, K. and Bukau, B. (2002). AAA+ proteins and substrate recognition, it all depends on their partner in crime. FEBS Lett. 529, 6-10. Kim, Y.I., Levchenko, I., Fraczkowska, K., Woodruff, R.V., Sauer, R.T. and Baker, T.A. (2001). Molecular determinants of complex formation between Clp/Hsp100 ATPases and the ClpP peptidase. Nat. Struct. Biol. 8, 230-233. Maurizi, M.R., Clark, W.P., Katayama, Y., Rudikoff, S., Pumphrey, J., Bowers, B. and Gottesman, S. (1990). Sequence and structure of ClpP, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J. Biol. Chem. 265, 12536-12545. Maurizi, M.R., Clark, W.P., Kim, S.H. and Gottesman, S. (1990). ClpP represents a unique family of serine proteases. J. Biol. Chem. 265, 12546-12552. Wang, J., Hartling, J.A. and Flanagan, J.M. (1997). The structure of ClpP at 2.3 A resolution suggests a model for ATP-dependent proteolysis. Cell 91, 447-456. Zeth, K., Ravelli, R.B., Paal, K., Cusack, S., Bukau, B. and Dougan, D.A. (2002). Structural analysis of the adaptor protein ClpS in complex with the N-terminal domain of ClpA. Nat. Struct. Biol. 9, 906-911. Guo, F., Esser, L., Singh, S.K., Maurizi, M.R. and Xia, D. (2002). Crystal structure of the heterodimeric complex of the adaptor, ClpS, with the N-domain of the AAA+ chaperone, ClpA. J. Biol. Chem. 277, 46753-46762. Schuenemann, V.J., Kralik, S.M., Albrecht, R., Spall, S.K., Truscott, K.N., Dougan, D.A. and Zeth, K. (2009). Structural basis of N-end rule substrate recognition in Escherichia coli by the ClpAP adaptor protein ClpS. EMBO Rep. 10, 508-514. Wang, K.H., Roman-Hernandez, G., Grant, R.A., Sauer, R.T. and Baker, T.A. (2008). The molecular basis of N-end rule recognition. Mol. Cell. 32, 406-414. 14