• Study Resource
  • Explore Categories
    • Arts & Humanities
    • Business
    • Engineering & Technology
    • Foreign Language
    • History
    • Math
    • Science
    • Social Science

    Top subcategories

    • Advanced Math
    • Algebra
    • Basic Math
    • Calculus
    • Geometry
    • Linear Algebra
    • Pre-Algebra
    • Pre-Calculus
    • Statistics And Probability
    • Trigonometry
    • other →

    Top subcategories

    • Astronomy
    • Astrophysics
    • Biology
    • Chemistry
    • Earth Science
    • Environmental Science
    • Health Science
    • Physics
    • other →

    Top subcategories

    • Anthropology
    • Law
    • Political Science
    • Psychology
    • Sociology
    • other →

    Top subcategories

    • Accounting
    • Economics
    • Finance
    • Management
    • other →

    Top subcategories

    • Aerospace Engineering
    • Bioengineering
    • Chemical Engineering
    • Civil Engineering
    • Computer Science
    • Electrical Engineering
    • Industrial Engineering
    • Mechanical Engineering
    • Web Design
    • other →

    Top subcategories

    • Architecture
    • Communications
    • English
    • Gender Studies
    • Music
    • Performing Arts
    • Philosophy
    • Religious Studies
    • Writing
    • other →

    Top subcategories

    • Ancient History
    • European History
    • US History
    • World History
    • other →

    Top subcategories

    • Croatian
    • Czech
    • Finnish
    • Greek
    • Hindi
    • Japanese
    • Korean
    • Persian
    • Swedish
    • Turkish
    • other →
 
Profile Documents Logout
Upload
Document
Document

... 1. More heat shock and stress-responsive genes (ex. those coding for heat shock proteins and chaperons) are highly expressed at 48˚C than are at lower temperatures, indicating that the fungus is under heat stress. 2. More putative virulence genes (ex. those coding for the proteins responsive to ox ...
Sequence Similarities of EST Clusters
Sequence Similarities of EST Clusters

... As for the IntFam-241 group, statistically enriched gene ontologies were ...
Supplementary Materials and Methods
Supplementary Materials and Methods

... applied to the same dataset (not shown). Concerned that the whole genome duplication (WGD) may have affected our prediction of orthologs within the lineage including S. cerevisiae, S. castellii and C. glabrata,59 we filtered 9 groups of orthologous genes (from our alignment of 139) that are affected ...
Human Gene Therapy
Human Gene Therapy

... regulatory elements, the coding sequences of human genes (exons) were found interspersed with noncoding intervening sequences (introns), ranging in size from a few base pairs to hundreds of thousands of base pairs. By what wondrous mechanisms could coding sequences placed apart over such distances b ...
PLEIOTROPIC EFFECT OF Rht3 DWARFING GENE ON SOME
PLEIOTROPIC EFFECT OF Rht3 DWARFING GENE ON SOME

... and Rht1S are prevalentin Southern European cultivars (W ORLAND and LAW 1986). There were trials of using some other Rht dwarfing genes, but without significant success (W ORLAND et al. 1980). For now, only strong dwarfing allel Rht3 (known as 'Tom Thumb' or 'Minister dwarf' gene) shows some breedin ...
Leukaemia Section t(X;7)(q22;q34) IRS4/TCRB  Atlas of Genetics and Cytogenetics
Leukaemia Section t(X;7)(q22;q34) IRS4/TCRB Atlas of Genetics and Cytogenetics

... The IRS family includes IRS1-4 which play a central role in maintaining basic cellular functions, e.g., growth and metabolism. They act as mediators between multiple growth factor receptors that possess tyrosine kinase activity, such as the insulin and insulin growth factor receptors, and a complex ...
Bombay Phenotype
Bombay Phenotype

... • Many traits characterized by a distinct phenotype are affected by more than one gene • Epistasis occurs when one gene masks the effect of another gene or when two gene pairs complement each other such that one dominant allele is required at each locus to express a certain phenotype. ...
Insulin-like signaling pathway
Insulin-like signaling pathway

... Morris et al., 1996 A phosphatidylinositol-3-OH kinase family member regulating longevity and diapause in Caenorhabditis elegans. ...
BLOOD CLOTTING CONDITIONS (HEREDITARY THROMBOPHILIAS)
BLOOD CLOTTING CONDITIONS (HEREDITARY THROMBOPHILIAS)

...  Emboli – partial blood clots that travel throughout the blood stream. Emboli may lodge within vessels of the lung (called a pulmonary embolism) or in the brain, causing a stroke. Both pulmonary embolism and stroke ...
Multifarious microarray-based gene expression patterns in response
Multifarious microarray-based gene expression patterns in response

... were until that time not associated with exercise. These data may help to characterize and define the complex stress response to acute and chronic exercise on the molecular level. In humans, the easiest accessible source to perform measurements of stress parameters on the cellular and molecular leve ...
mnw2yr_lec17_2004
mnw2yr_lec17_2004

... Daly et al (2001) were able to infer offspring haplotypes largely from parents. They say that “it became evident that the region could be largely decomposed into discrete haplotype blocks, each with a striking lack of diversity“ The haplotype blocks: – Up to 100kb – 5 or more SNPs For example, this ...
The quest for the entrepreneurial gene
The quest for the entrepreneurial gene

... Almost all human DNA is identical from person to person. To date, geneticists have identified 27 million SNPs among humans, while the entire human genome consists of some three billion nucleotides. These SNPs and other types of genomic variation are what make humans different from each other. The t ...
PowerPoint Slides
PowerPoint Slides

...  The Chothia numbering scheme is identical to the Kabat scheme, but places the insertions in CDR-L1 and CDR-H1 at the structurally correct positions. This means that topologically equivalent residues in these loops do get the same label (unlike the Kabat scheme).  The IMGT unique numbering for all ...
Introduction to GeneBreak
Introduction to GeneBreak

... * Correspondence to: Christian Rausch ([email protected]) or Sanne Abeln ([email protected]) ...
Dosage Compensation: Transcription-Level Regulation of X
Dosage Compensation: Transcription-Level Regulation of X

... and females) is explained by this formulation if one considers that, since the cells and their nuclei are proportionately larger, the concentration of the inhibitor in these forms is two-thirds of its value in diploids. One extreme version of this model would have separate regulatory elements for ea ...
Genetics Notes
Genetics Notes

... • Colorblindness-Most common type is red/green colorblindness. There are 3 types of cones in the eye red, green and blue. A person who is colorblind generally lacks 1 of the 3 cones. 10% of all males are colorblind and only 0.4% of females. To be affected a man only needs to receive one recessive ge ...
doc
doc

... B. Gain a homing endonuclease domain and turn into inteins. C. Subfuctionalization (Both copies retain only part of the original function). D. Neofunctionalization (Acquires a new function). E. Sit around semi-permanently as junk DNA. 15. Which statement is NOT in support of the Duplication-Degenera ...
CILJANA MUTAGENEZA I GENETSKI MARKERI U SELEKCIJI SVINJA
CILJANA MUTAGENEZA I GENETSKI MARKERI U SELEKCIJI SVINJA

... control many pigs characteristics. Truncated form of porcine GH, esspecially C-terminal portion of the recombinant PGH, including particular the last eight AA, is of major importance in the binding of PGH to the pig liver membrane GH receptor (P u r i e t a l ., 1993). Significant proportion of an t ...
Ch 23 Evolution - philipdarrenjones.com
Ch 23 Evolution - philipdarrenjones.com

... can  evolve  at  some  loci   •  while  being  in  Hardy-­‐Weinberg   equilibrium     •  at  other  loci   ...
D - mbg
D - mbg

... VHLTDAKAAVSCGNSDEVGEGLVTQYDSDLSSASAIMGAK   >Rat   VHLTDAKAAVNGGNPDDVGEGLVTQYDSDLSSASAIMGPK   >Duck   VHWTAEKQLITGGNVADCAEALITQFASNLSSPTAILGPM   >Goose   VHWTAEKQLITGGNVADCAEALITQFSSNLSSPTAILGPM   >Crocodile   ASFDPHKQLIGDHDVAHCGESMIKRYENDISNAQAIMHEK   >Alligator   ASFDAHRKFIVDADV ...
- Free Documents
- Free Documents

... eukaryotes, a cloned animal or plant gene that has been introduced into a bacterium can often direct the bacterium to produce its protein product, which can then be purified and used for biochemical experimentation. Cloned genes can also be used for DNA sequencing, which is the determination of the ...
AIR Inquiry
AIR Inquiry

... (generation of a null segregant line). The final plant line produced by the CRISPR-Cas gene knockout technology is selected to contain no randomly integrated DNA material and is indistinguishable from plants that could result from native genome variability or be developed in a conventional breeding ...
Keystone2011poster
Keystone2011poster

... The sequencing and phylogenetic analysis of rRNA molecules demonstrated that all organisms could be placed on a single tree of life. Highly conserved, homologous 16S rRNA genes' presence in all organismal lineages makes them the only universal marker that has been adopted by biologist. Unfortunately ...
July, 2004 - Think Muscle
July, 2004 - Think Muscle

... two ambitions. Gut buff on the one hand, and get cut on the other. In this article we’ll explore the dilemma faced by all those who want it all. There are primarily two things that effect how we look in the mirror, how fat we are and how muscular we are. We focus on these two things because ultimate ...
X-linked Alleles
X-linked Alleles

... Colorblindness (1 in 10 males, 1 in 100 females) •Controlled by three genes on X chromosome •In males, a defect in any one of them produces red-green colorblindness •Women are much less likely to have red-green colorblindness because they have two copies of each gene, two chances to get it right. M ...
< 1 ... 203 204 205 206 207 208 209 210 211 ... 403 >

Gene desert

  • studyres.com © 2026
  • DMCA
  • Privacy
  • Terms
  • Report